Conserved Protein Domain Family
CitF

?
pfam04223: CitF 
Click on image for an interactive view with Cn3D
Citrate lyase, alpha subunit (CitF)
In citrate-utilising prokaryotes, citrate lyase EC:4.1.3.6 cleaves intracellular citrate into acetate and oxaloacetate, and is organised as a functional complex consisting of alpha, beta, and gamma subunits. The gamma subunit serves as an acyl carrier protein (ACP), and has a 2'-(5''-phosphoribosyl)-3'-dephospho-CoA prosthetic group. The citrate lyase is active only if this prosthetic group is acetylated; this acetylation is catalyzed by an acetate:SH-citrate lyase ligase. The alpha subunit substitutes citryl for the acetyl group to form citryl-S-ACP. The beta subunit completes the reaction by cleaving the citryl to yield oxaloacetate and (regenerated) acetyl-S-ACP. This family represents the alpha subunit EC:2.8.3.10.
Statistics
?
PSSM-Id: 113013
View PSSM: pfam04223
Aligned: 6 rows
Threshold Bit Score: 836.376
Threshold Setting Gi: 81537994
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HJ0_A       45 DDKLLSSIHEAIEKTRLKDGXTISFHHHFREGDYVXNXVLDEIAKXGIKDISIAPSSIANVH-EPLIDHIKNGVVTNITS 123
gi 2498238   43 DRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH-APLVEHIRQGVVTRIYT 121
gi 81545289  66 SRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCH-SPLIEHIKNGVVSKIYT 144
gi 81533643  45 DSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIANVH-EPLIDHIKNGVVTNITS 123
gi 81537994  45 pNKLVDSLEEVVLKT-VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLTNVMnDILVEAIEKGVVTNITS 123
gi 1168950   33 DRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSH-FPIVEHIKNGVVTKIYS 111
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HJ0_A      124 SGLRDKVGAAISEGIXENPVIIRSHGGRARAIATDDIHIDVAFLGAPSSDAYGNANGTRGKTTCGSLGYAXIDAKYADQV 203
gi 2498238  122 SGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAKQV 201
gi 81545289 145 SGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGKSNCGSLGYAKVDAEHAEKV 224
gi 81533643 124 SGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTKGKATCGSLGYAMIDAKYADQV 203
gi 81537994 124 SGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMDGKAPFGSLGYALMDAQYADTV 203
gi 1168950  112 SGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFTGKSKCGSLGYARVDAEYADKV 191
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HJ0_A      204 VIVTDTLVPYPNTPISIPQTDVDYIVVVDAIGDPEGIAKGATRYTKNPKELLIAEYAAKVITSSPYYKEGFSFQTGTGGA 283
gi 2498238  202 VMLTEELLPYPHNPASIEQDQVDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA 281
gi 81545289 225 VMLTEAIVGFPNFPASITQDRVDAVVQVAEVGDPSKIGGDATRMTTNPRELLIAKRAAEVIEHSGYFYDGFSMQTGSGGA 304
gi 81533643 204 VILTDNLVPYPNTPISIPQTDVDYVVTVDAIGDPQGIAKGATRFTKNPKELLIAEYAAKVITNSPYFKEGFSFQTGTGGA 283
gi 81537994 204 VAITDSLVSYPNTPASIKQTQVDYVVKIDAVGNPDKIGAGATRFTKDPKELKIASMVNDVIVNSPYFKNGFSFQTGTGGA 283
gi 1168950  192 VLLTEEFVEYPHHPISIAQDQVDLIVQVEAVGDPKKIGGGATRMTTNPRELLIARKCAEVIFASGYFKDGFSLQTGSGGA 271
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HJ0_A      284 SLAVTRFXREQXIKDDIKANFALGGITNAXVELLEEGLVDKILDVQDFDHPSAVSLDRNAEkHYEIDANXYASPLSKGSV 363
gi 2498238  282 SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARNPN-HIEISANQYANWGSKGAS 360
gi 81545289 305 SLAVARFLKEKMLRQDIRASFALGGITATMVDMHEQGLIDYLLDVQCFDSVAAGSLARNPH-HLEISANEYANPSSKGAA 383
gi 81533643 284 SLAVTRFMREAMIKENIKASFALGGITNAMVELLEEELVEKILDVQDFDHPSAVSLGKHAE-HYEIDANMYASPLSKGAV 362
gi 81537994 284 ALAVTRFLRQSMIDHNVKATFGLGGITKPMVDLLEEGLVDKLMDVQDFDGGSAQSMHLNKN-QQEIDASWYADPANKGAM 362
gi 1168950  272 ALAVTRFLEEKMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLARNPN-HIEVSANQYANYSSKGAS 350
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2HJ0_A      364 INQLDICVLSALEVDTNFNVNVXTGSDGVIRGASGGHCDTAFAAKXSLVISPLVRGRIPTFVDKVNTVITPGTSVDVVVT 443
gi 2498238  361 VDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCDTAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVT 440
gi 81545289 384 VDRLDVVILSALEIDTQFNVNVITGSDGVIRGASGGHCDTAAAANLSIIVAPLVRGRIPTVVEKVTNVITPGSTIDVLVT 463
gi 81533643 363 INQLDTCILSALEVDTNFNVNVMTGSDGVIRGASGGHCDTAFAAKMSLVISPLIRGRIPTFVDEVNTVITPGTSVDVIVT 442
gi 81537994 363 VDKLDVVILSALEIDTKFNVNVMSGSDGVIRGAIGGHQD-AGTAKLTIISAPLVRGRIATVVPDVTTVITPGDSIDVLVT 441
gi 1168950  351 VERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAIIVAPLVRGRIPTVVENVITCVTPGENVDILVT 430
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
2HJ0_A      444 EVGIAINPNRPDLIEYFKDLK-VPQLTIEELKEKAYAIVGNPQPIQYGDKIVALIEYRDGSLIDVVRNV 511
gi 2498238  441 DHGIAVNPARPELAERLQEAG-IKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQV 508
gi 81545289 464 DQGIAVNPNRPELKARFIEAQ-LPVVEIEALQQRAELLTGKPQPLQFEDKTVAFVHYRDGSIIDVIKQV 531
gi 81533643 443 EVGIAINPNRQDLVDHFKSLN-VPQFSIEELKEKAYAIVGTPERIQYGDKVVALIEYRDGSLMDVVYNV 510
gi 81537994 442 EIGIAINPKRTDLLDKLSNIPgLPVYTIEELQKIAEEKLGKPEPLEFTDKVVALIEYRDGSLLDIIREV 510
gi 1168950  431 DHGVAVNPKRPDLIEALSKTD-IPLFTIEQLCERAYSITGKPKEIEFTNKPVAVVRYRDGSVIDTVYQV 498
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap