Conserved Protein Domain Family
DUF561

?
pfam04481: DUF561 
Protein of unknown function (DUF561)
Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Statistics
?
PSSM-Id: 113257
View PSSM: pfam04481
Aligned: 5 rows
Threshold Bit Score: 333.256
Threshold Setting Gi: 401515
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175703    3 LRNn--K--LHSSFIQRKAIKVISGINNFNVGQIFKIIHACEISKATYVDVARNPKIVSFIK-SISSIPVCVSSIDPRAL 77
gi 81670462   1 MSAnlaQ--LHQALENRTALKVISGLNNFDSANVLAVARAAQAGGATFVDIAADRQLIQQVR-HAIDLPICVSAVEAELL 77
gi 1723327    3 ISS---K--ISSDFDKQSALKVITGLNNFNIPQIKQMALASEIAKVTYLDIVADTDIIKEVE-SVSKIPICVSAVKSKEL 76
gi 14424116   1 MVN---KsqVLLDIANKKAIKVISGLTNLNYEHVLTIARASQRACVSYIDIAADPQLVKVVK-ANVNIPICVSGLEIQPI 76
gi 401515     1 MNN---K--IDNFLKQKKLIKVISGLNNFNTTHVIKIAKAASKTNASFIDIAAAPKLVEKVKkEVPNLPICVSAIKPELF 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175703   78 YESVLAGADLVEIGNFDCFYTNGVYLSNDQIIAIVKQVKYLLPYTDICVTIPHILKLHEQIYLAQKLESLGINLLQTEGS 157
gi 81670462  78 AEAVAAGADLVEIGNFDSFYAQGRRFEGPEVLALTKATRQLLPHTLLSVTVPHILALDEQVQLAEALVAAGADIIQTEGG 157
gi 1723327   77 LKCQKTGVNILEIGNYDCFYEQGRLFHSEEIKLISKETRNLLPHATLCVTLPHILKIEEQVKLASDLQRIGIDMIQTEGK 156
gi 14424116  77 YNAVLAGADLIEVGNYESLYKRNTVLSVCKIITLVEEIKKLCPRVPLTVTIPYILNQKDQINLCKQLESLRVDYIQTEG- 155
gi 401515    76 VPCVKAGAELIEIGNFDSLYNQGYKINFSDVLSLVKQTRSLLPDTPLSVTIPYLLPLNLQLELAYRLEDLNVDLIQTEGK 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175703  158 ITNFSnekllEAKKINDNILYSTSmaccALSSVYSISKVVSLPVIASSGINGISASVALSYGASGIGIRSSVSKLGNIID 237
gi 81670462 158 TSAEP-----HHPGVLGLIEKAAP----TLAAAHAISRAVNVPVLCASGLSDVTVPMAIAAGASGVGVGSAINQLNDQVA 228
gi 1723327  157 STSIS-----KTDHLSGMIQKSAS----TFSSTYTVSSKIRLPIISASGISSLTSPIAFLYGASGIGIGSNIRRLQDIGS 227
gi 14424116 156 -NSISk---cKNHCVQDLLRLSLQ----TLACTYELVKHTQLPIICSSGLSDVTVPLAFSLGASGIGIGKFVTSYYEEEK 227
gi 401515   156 INKIT------SLLDNRNIETILP----TLASTYLIANNVTIPVICASGLTISTIELPFKLNASGIGIGNAVSKLNSTEE 225
                       250
                ....*....|....*...
gi 1175703  238 MSNYIDEMIFSTSKKLYD 255
gi 81670462 229 MVAAVRRLADALVAQPVR 246
gi 1723327  228 MVIYIYEVQAAISSNHNI 245
gi 14424116 228 IVSILSKIKKIVSGTRSY 245
gi 401515   226 MINLLNEISTRINYSTVL 243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap