Conserved Protein Domain Family
DUF575

?
pfam04746: DUF575 
Protein of unknown function (DUF575)
Family of uncharacterized proteins. Contains several chlamydial members.
Statistics
?
PSSM-Id: 113513
View PSSM: pfam04746
Aligned: 6 rows
Threshold Bit Score: 165.302
Threshold Setting Gi: 75532575
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75414970   19 AFNFSRPLYSRITHFALGVIKAIPIVGHLVMGVDWLISHCFERGVSHPGFPSDIAPILKVEKIAGRDHISRIENQLKSLR 98
gi 81790071   19 AFDFTRPLGSRITNFALGVIKAIPILGCVVIGVSWLVSTCSARRFGKPAFTSDVASIVKIEKTRGYNPLAWVEQYLRQLR 98
gi 75532575   19 AFDFTRSLCSRISNFALGVIALLPIIGQLYVGLDWLLSR-----IKKPEFPSDVDQIVRVEHVVGHDHRSRVEDILKRQR 93
gi 499185562  20 AFDFTHPVCSRITNFALGIIKAIPVLGHIVMGIEWLISWIPRHTVRHGMFTSDVSSAIKVEQTRGHNCLAPLEAYLSSLR 99
gi 499185559  31 AFDFSRPFCSRVTNFALGVIKAIPIVGHIVMGMEWLVSSCVAGIITRSSFTSDVVQIVKTEKALGRDHISRVAEILQRER 110
gi 499185558  19 AFDFSLPFCARITEFVLGVIKGIPVVGHIIVGIEWLVSRYLESFVTKPTFVSDVVSLLKTEKVAGRDHIARVVETLKRQR 98
                         90       100
                 ....*....|....*....|.
gi 75414970   99 KTIEVEDLDKVHGQYQENPYA 119
gi 81790071   99 VRLPEGDLGKIHGKVSRDYVC 119
gi 75532575   94 LSLEPRDEGKVRGDLPSAPFF 114
gi 499185562 100 VPISQEDLGKVHGRTPEDPFV 120
gi 499185559 111 GTITPENQDKVHGKFPVCPFG 131
gi 499185558  99 VAVAPEDEDKVHGKIPVHPFG 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap