Conserved Protein Domain Family
DUF681

?
pfam05080: DUF681 
Protein of unknown function (DUF681)
This family contains several uncharacterized beak and feather disease virus proteins.
Statistics
?
PSSM-Id: 113835
View PSSM: pfam05080
Aligned: 2 rows
Threshold Bit Score: 182.941
Threshold Setting Gi: 81923886
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81923886   1 MGGACIASRYWLVPARVILRLRLTSFTGHRGVARVDGPMSSLGPNIIKCAVNGGMDMMGKMSSSWTTFMGGYLIARCSAS 80
gi 81969113   1 MGGACTTFHYWLVPTHVTSRRKSTLCTAPRGVARADGPMNSLVLNFIKCAVSGGMDMTGKISSSLTTSMGGSLIARCSAL 80
                        90       100
                ....*....|....*....|.
gi 81923886  81 ATVTHIKCQLRALLWSLRARG 101
gi 81969113  81 WTVTHIRCQLRAPLWSLPARG 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap