Conserved Protein Domain Family
Brucella_OMP2

?
pfam05244: Brucella_OMP2 
Brucella outer membrane protein 2
This family consists of several outer membrane proteins (2a and 2b) from brucella bacteria. Brucellae are Gram-negative, facultative intracellular bacteria that can infect many species of animals and man.
Statistics
?
PSSM-Id: 113995
View PSSM: pfam05244
Aligned: 2 rows
Threshold Bit Score: 331.787
Threshold Setting Gi: 75346701
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75346701  79 MRSLQVEGSLLRSLILQTTPDSPIAAPLTVVLVRRRCGRICALQPYREPVGDVDVATNLCSPFFDDRVIGNNTSDRTPAA 158
gi 841487    79 MRSLQIEGCLFGGNELCTTPDSPIAAPLTVVLVRRRCGRICALQPNRELVGDVDVATNLGSPFFDDRVIGNNTSDRTPAA 158
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75346701 159 SIFQAANNVRHVTVDRV-----IVVNVFATLFESDHSREAVSAGEGVGDLAGAVGASRDHVIVDDITEVTGEGMEFGFVD 233
gi 841487   159 SILQAANNVRHVAVDVVvgrasVTTVVVATLFESDHSREAVSASEGVRDLAGAVGASRDHVIVDDIAEVTGEGMEFRFID 238
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75346701 234 TNLETTKRDICKLQIGAGA--------YAAI-----S-----------------------------DITIIAEIAVLAIM 271
gi 841487   239 TNAQTTELDIRELHDGAAAgfitiftiYARIvrsivEaqfgeglegaefgfrtggnaecetsalvpAIAVGTGVNVIAAL 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap