Conserved Protein Domain Family
Peptidase_C33

?
pfam05412: Peptidase_C33 
Equine arterivirus Nsp2-type cysteine proteinase
Corresponds to Merops family C33. These peptidases are involved in viral polyprotein processing in replication.
Statistics
?
PSSM-Id: 114153
View PSSM: pfam05412
Aligned: 4 rows
Threshold Bit Score: 200.141
Threshold Setting Gi: 62510944
Created: 20-Jul-2016
Updated: 11-Dec-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968041   428 HYSPPAEGNCGWHCISAIANRMVNSKFETTLPERVRPPDDWATDEDLVNAIQILRLPAALdrnGACTSAKYVLKLEGEHW 507
gi 62510944   381 GYSPPGDGACGLHCISAMLNDIFGDSFTTRLGKCSRDSSEWLSDQDLYQLVMTANLPATI---GHCPSAIYKLDCVNQHW 457
gi 62510951   381 GYSPPGDGACGLHCISAIINDIFGDALCTKLTNCSRDSSEWLSDQDMYQLVMTARLPATL---GHCPSATYKLDCVNQHW 457
gi 302393818  420 TYSPPTDGSCGWHVLAAIMNRMINGDFTSPLTQYNRPEDDWASDYDLVQAIQCLRLPATVvrnRACPNAKYLIKLNGVHW 499
                          90       100       110
                  ....*....|....*....|....*....|
gi 81968041   508 TVTVTPG-MSPSLLPLECVQGCC-GHKGGL 535
gi 62510944   458 TVTKRKGdRAVGRLAPDCLRGVCgECEMGI 487
gi 62510951   458 TVTKRKGdRALGGLSPECVRGVC-GGECKF 486
gi 302393818  500 EVEVRSG-MAPRSLSRECVVGVC-S-EGCV 526
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap