Conserved Protein Domain Family
SCP-1

?
pfam05483: SCP-1 
Synaptonemal complex protein 1 (SCP-1)
Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.
Statistics
?
PSSM-Id: 114219
View PSSM: pfam05483
Aligned: 2 rows
Threshold Bit Score: 1050.85
Threshold Setting Gi: 209572682
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729    28 AGGDSNYFKTVNKCTEGDFGVPLTMSSLSKNRENIDTDPAFQKLSILPMLEQVANSgSCHYQEGVNDSDFENSEPMSRLY 107
gi 209572682  28 LGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNS-DCHYQEGLKDSDLENSEGLSRVY 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   108 SKLYKEAEKIKKWKVSIESELKQKENKLQENRKIIEAQRKAIQELQFENEKVSLKLEEEIQENKDLIKENNATRHWCNLL 187
gi 209572682 107 SKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQELQFGNEKVSLKLEEGIQENKDLIKENNATRHLCNLL 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   188 KETCARSAEKTSKYEYEREETRQVYVDLNNNIEKMILAFEELRVQAENARLEMHFKLKEDHEKIQHLEEEYQKEVNNKEN 267
gi 209572682 187 KETCARSAEKTKKYEYEREETRQVYMDLNNNIEKMITAFEELRVQAENSRLEMHFKLKEDYEKIQHLEQEYKKEINDKEK 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   268 QVSLLLIQSTEKENKMKDLTFLLEESRDKANQLEEKTKLQDENLKELNEKKDHLTSELEDIKMSMQRSMSTQKTLEEDLQ 347
gi 209572682 267 QVSLLLIQITEKENKMKDLTFLLEESRDKVNQLEEKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQ 346
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   348 IATKTIYQLTEEKEAQMEELNKAKTTHSLVVTELKATTCTLEELLRTEQQRLENNEDQLKLITMELQKKSSELEEMTKFK 427
gi 209572682 347 IATKTICQLTEEKETQMEESNKARAAHSFVVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELEEMTKLT 426
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   428 NNKEVELEELKTILAEDQKLLDEKKQVEKLAEELQGKEQELTFLLQTREKEIHDLEVQVTVTKTSEEHYLKQVEEMKTEL 507
gi 209572682 427 NNKEVELEELKKVLGEKETLLYENKQFEKIAEELKGTEQELIGLLQAREKEVHDLEIQLTAITTSEQYYSKEVKDLKTEL 506
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   508 EKEKLKNIELTANSDMLLLENKKLVQEASDMVLELKKHQEDIINCKKQEERMLKQIETLEEKEMNLRDELESVRKEFIQQ 587
gi 209572682 507 ENEKLKNTELTSHCNKLSLENKELTQETSDMTLELKNQQEDINNNKKQEERMLKQIENLQETETQLRNELEYVREELKQK 586
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   588 GDEVKCKLDKSEENarsieyevlkkekqmkilenkCNNLKKQIENKSKNIEELHQENKALKKKSSAENKQLNAYEIKVNK 667
gi 209572682 587 RDEVKCKLDKSEEN---------------------CNNLRKQVENKNKYIEELQQENKALKKKGTAESKQLNVYEIKVNK 645
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3041729   668 LELELASTKQKFEEMINNYQKEIEIKKISEEKLLGEVEKAKATVDEAVKLQKEIDLRCQHKIAEMVALMEKHKHQYDKIV 747
gi 209572682 646 LELELESAKQKFGEITDTYQKEIEDKKISEENLLEEVEKAKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQYDKII 725
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 3041729   748 EERDSELGLYKNREQEQSSAKVALETELSNIRNELVSLKKQLEVEKEEKEKLKME-QENTAILTDKK 813
gi 209572682 726 EERDSELGLYKSKEQEQSSLRASLEIELSNLKAELLSVKKQLEIEREEKEKLKREaKENTATLKEKK 792
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap