Conserved Protein Domain Family
Pneumo_att_G

?
pfam05539: Pneumo_att_G 
Pneumovirinae attachment membrane glycoprotein G
Statistics
?
PSSM-Id: 114270
View PSSM: pfam05539
Aligned: 3 rows
Threshold Bit Score: 508.049
Threshold Setting Gi: 81969063
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935556   1 MGSELYIIEGVSSSEIVLKQVLRRSQKILLGLVLSALGLTLTSTIVISICISVEQVKLRQCvDTYWAENGSLHPGQSTEN 80
gi 81969063   1 MGAKLYAISGASDAQLMKKTCAKLLEKVVPIIILAVLGITGTTTIALSISISIERAVLSDC-TTQLRNGTTSGSLSNPTR 79
gi 505315     1 MGSKLYMVQGTSAYQTAVGFWLDIGRRYILAIVLSAFGLTCTVTIALTVSVIVEQSVLEEC-RNYNGGDRDWWSTTQEQP 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935556  81 TSTRGKTTTKDPRRLQATGAGKFESCGYVQVVDGDMHDRSYAVLGGVDCLGLLALCESGPICQGDTWSEDGNFCRCTFSS 160
gi 81969063  80 STTSTAVTTRDIRGLQTTRTRELKSCSNVQIAYGYLHDSSNPVLDSIGCLGLLALCESGPFCQRNYNPRDRPKCRCTLRG 159
gi 505315    80 TTAPSATPAGNYGGLQTARTRKSESCLHVQISYGDMYSRSDTVLGGFDCMGLLVLCKSGPICQRDNQVDPTALCHCRVDL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935556 161 HGVSCCKKPKSKATTAQRNSKPANSksTPPVHSDRASKEHNPSQGEQPrrgpTSSKTTIASTPS--TEDTAKPTISKPKL 238
gi 81969063 160 KDISCCKEPPTAVTTSKTTPWGTEV--HPTYPTQVTPQSQPATMAHQT----ATANQRLSTTEPvgSQGNTTSSNPEQQT 233
gi 505315   160 SSVDCCKVNKIS-TNSSTTSEPQKt--NPAWPSQDNTDSDPNPQGITT----STATLLSTSLGLmlTSKTGTHKSGPPQA 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935556 239 TIRPSqrgpsgsTKAASSTPSHKTNT-RGTSKTTDQRPRTGPTPERPRQThstatpppTTPIHKGRAPTPKPTTDLKVNP 317
gi 81969063 234 EPPPS-------PQHPPTTTSQDQSTeTADGQEHTPTRKTPTATSNRRSP--------TPKRQETGRATPRNTATTQSGS 298
gi 505315   233 LPGSNtngktttDRELGSTNQPNSTT-NGQHNKHTQRMTLPPSYDNTRTIlqhttpweKT--FSTYKPTHSPTNE----- 304
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935556 318 REGSTSPTAIQKNPTTQsnlvdCTLSDPDEPQRICYQVGTYNPSQSGTCNIEVPKCSTYGHACMATLYDTPFNCWRRTRR 397
gi 81969063 299 SPPHSSPPGVDANMEGQ-----CKELQAPKPNSVCKGLDIYREALPRGCDKVLPLCKTSTIMCVDAYYSKPPICFGYNQR 373
gi 505315   305 --------SDQSLPTTQns-inCEHFDPQGKEKICYRVGSYNSNITKQCRIDVPLCSTYNTVCMKTYYTEPFNCWRRIWR 375
                       410
                ....*....|....*.
gi 81935556 398 CICDSGGELIEWCCTS 413
gi 81969063 374 CFCMETFGPIEFCCKS 389
gi 505315   376 CLCDDGVGLVEWCCTS 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap