Conserved Protein Domain Family
Bt_P21

?
pfam05560: Bt_P21 
Bacillus thuringiensis P21 molecular chaperone protein
This family contains several Bacillus thuringiensis P21 proteins. These proteins are thought to be molecular chaperones and have mosquitocidal properties.
Statistics
?
PSSM-Id: 114291
View PSSM: pfam05560
Aligned: 2 rows
Threshold Bit Score: 314.298
Threshold Setting Gi: 446060374
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75490778    2 DAENRAFYKIFTLKNNNLCKNSTLLEKIFKNNVEEFDFSLVKQNLEHEKNCVITSTMNQTIFFENMNSKEMGNKAYSFFN 81
gi 446060374   1 MTENGVFYKIFTTENNNFCINPTLLERVFKNNLDEFDFSLVKKNLEHEKNCVITSTMNQTISFENMNSTEMGHKTYSFLN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75490778   82 QTVLNNKGNTSLEEQISDIFDRCVYMNAEKSSSYIKLLEQDYNQVDMFVSLIFIGPYRHNLILITPVTLHLTLIPKNVKN 161
gi 446060374  81 QTVLNNKGNSSLEEQVSNIFYRCVYMEVGKSSSYIKPLEQDSNKIRYVCSLLFIVPYKNNITSIIPVNLQLTLLSKNVKQ 160
                        170       180
                 ....*....|....*....|..
gi 75490778  162 NSFKNLFSGDMHFNMVTMTHLT 183
gi 446060374 161 SSSTNIFSGDIHFNMVTMTYLT 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap