Conserved Protein Domain Family
ASFV_J13L

?
pfam05568: ASFV_J13L 
African swine fever virus J13L protein
This family consists of several African swine fever virus J13L proteins.
Statistics
?
PSSM-Id: 114299
View PSSM: pfam05568
Aligned: 2 rows
Threshold Bit Score: 263.268
Threshold Setting Gi: 81993371
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935525   1 MDSEFFQPVYPRHYGECLSPVSTPSFFSTHMYTILIAIVVLIIIIIVLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWS 80
gi 81993371   1 MDSEFFQPVYPRHYGECLSSTPAPSFFSTHMYTILIAIVVLIIIIIVLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81935525  81 EVTPQPGTSKPAGATTASAGKPVTDRPATNrlvadRPATNRPVMDNPVMATGGPEAASATAsaaasdpaYPAEPYTTVTT 160
gi 81993371  81 GVTPQPGIAKPAGASTGSAGKPVMGRPVTN-----KPVTNKPVTDRLGMAAGGPAAASAPA--------HPAELYTTATT 147
                       170       180
                ....*....|....*....|....*....
gi 81935525 161 QNTASQTMSAIENLRQRSTYTHKDLENSL 189
gi 81993371 148 QNTASQTMPADENLRQRNTYTHKDLENSL 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap