Conserved Protein Domain Family
V_cholerae_RfbT

?
pfam05575: V_cholerae_RfbT 
Vibrio cholerae RfbT protein
This family consists of several RfbT proteins from Vibrio cholerae. It has been found that genetic alteration of the rfbT gene is responsible for serotype conversion of Vibrio cholerae O1 and determines the difference between the Ogawa and Inaba serotypes, in that the presence of rfbT is sufficient for Inaba-to-Ogawa serotype conversion.
Statistics
?
PSSM-Id: 114305
View PSSM: pfam05575
Aligned: 2 rows
Threshold Bit Score: 550.823
Threshold Setting Gi: 75427974
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75350098   1 MKHLIKNYVQKLIKTELDAIQSKSVHDNRNFIYNGEFLILESEFGWHCFPRVQLNHALSYKNPNFDLGMRHWIVNHCKHD 80
gi 75427974   1 MKHLIKNYVQKLIKTELDAIQSKSVHDNRNFIYNGEFLILESEFGLHCFPRVQLNHALSYKNPNFDLGMRHWIVNHCKHD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75350098  81 TTYIDIGANVGTFCGIAARHITQGKIIAIEPLTEMENSIRMNVQLNNPLVEFHHFGCAIGENEGENIFEVYEFDNRVSSL 160
gi 75427974  81 TTYIDIGANVGTFCGIAARHITQGKIIAIEPLTEMENSIRMNVQLNNPLVEFHHFGCAIGENEGENIFEVYEFDNRVSSL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75350098 161 YFKKNTDIADKVKNSQVLVRKLSSLDISPTNSVVIKIDAEGAEIEILNQIYEFTEKHNGIEYYICFEFAMGHIQRSNRTF 240
gi 75427974 161 YFQKNTDIADKVKNSQVLVRKLSSLDISPTNSVVIKIDAEGAEIEILNQIYEFTEKHNGIEYYICFEFAMGHIQRSNRTF 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 75350098 241 DEIFNIINSKFGSKAYFIHPLSSAEHPEFNKATQDINGNICFKYVS 286
gi 75427974 241 DEIFNIINSKFGSKAYFIHPLSSAEHPEFNKATQDINGNICFKYVS 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap