Conserved Protein Domain Family
Ustilago_mating

?
pfam05722: Ustilago_mating 
Ustilago B locus mating-type protein
This family consists of several Ustilago mating-type proteins. The b locus of the phytopathogenic fungus Ustilago maydis encodes a multiallelic recognition function that controls the ability of the fungus to form a dikaryon and complete the sexual stage of the life cycle. The b locus has at least 25 alleles and any combination of two different alleles, brought together by mating between haploid cells, allows the fungus to cause disease and undergo sexual development within the plant.
Statistics
?
PSSM-Id: 114448
View PSSM: pfam05722
Aligned: 2 rows
Threshold Bit Score: 418.83
Threshold Setting Gi: 287657
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119370301 185 ILKKFAREDRSRMKHLVRAKLSSSNQSTPPSSTSDSLSNNLDDVLSDNLGRpLTPVDKQQFEDDWASMISWIKYGVKEKV 264
gi 287657    184 IVRKFARNDRNRMKLLVQAKMLASDPSARAIATQSSLVGNLDDLLRENLGH-LTPADKEEFEDDWNSMISWIKYGVKEKV 262
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119370301 265 GDWVYDLCAASKKT-PKPGMPRPVTTVAKRHPARKTKPAAKPKSRTANPRASTTPSIDSTldsSKLESTPELSMCSTADT 343
gi 287657    263 GDWVYDLVAANKKSpPRTGQARAVTTAANRSPARKTATKTQTKPKKAKQRASKTPSMDST---SALESTPELSACSTADN 339
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119370301 344 SFSTFGSSLSMSHYNPFQDgNDILQSPTVKARGNRKVKALPKRAGKQQPDE---VDN----------------------- 397
gi 287657    340 SFSSFCSNGSLGQHDPFQQ-YQLQQSPSLNTRGGRKVKALPKRAAQKLPAEalyINNnesgsidtcypvpeerktalsla 418
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 119370301 398 -----------------------------GKIPFL---------CLSVAFV 410
gi 287657    419 sealaqasgqtnsylpaskqqmfppydamGQIPFVprrenlssnSLSAAFG 469
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap