Conserved Protein Domain Family
Ac76

?
pfam05814: Ac76 
Orf76 (Ac76)
This family consists mainly of baculovirus proteins. Family members include Autographa californica multiple nucleopolyhedrovirus (AcMNPV), protein AC76. Ac76 has been shown to be involved in intranuclear microvesicle formation. Functional studies suggest that ac76 is essential for both BV (budded virus) and ODV (occlusion-derived virus) development but is not required for viral DNA synthesis.
Statistics
?
PSSM-Id: 114536
View PSSM: pfam05814
Aligned: 15 rows
Threshold Bit Score: 74.2558
Threshold Setting Gi: 1175101
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81981621   1 MFIYYTFLMLIALGFIFDRNEGISNLLLFMLLVFIIFILMLQVMYI--KPESSdAADLQTGKAKSIKKKRDLERAFDAIL 78
gi 123860367  1 MTLFATFLVLILIGFLFDKNDGLLNVMLYLFMLFVVFIFLLQIYYI--KPQST-TADLQTGKSKSIKKKRDLERAFDAIL 77
gi 123852190  1 MFMYFTFLVLILLGFIFDKNEGFSNLLLFMLLLFVTFIMLLQIYYI--KPEST-TADLPTVKAKSIKKKRDLERAFDAII 77
gi 1175101    1 MNLYLLLGALAIFSLVYDKKE--NSIFLYLLILFLVFII-VSPAIIskNTEST-VEDIPSHKAKSVRKKLEIEQALDAIL 76
gi 81961208   1 MLIFFTFI-LITLSFIFDRNNGMSNLILFVLLLFIIFVALLHVYYV--KPASN-TTDLQTDKSKRIKKKRDLEKALDAII 76
gi 123875737  1 MFIYLAFALLITLSFIFDKTKSMSNLIVFVLLLCVVFIILLNVYYV--KPPST-TADLQTDKSKRTKKKRDLEKALDAII 77
gi 81968720   1 MLL--GLIAFIIIALLMNKTAMGSELIITCLILFVLFFCILNVYYV--NNEST---DLYTADTKKIKKRQQLSDAFDAIL 73
gi 81950489   1 MLTISLVVGLVVFAFIINRYTTSSEMIVTMLVLVVLFFCILNYYYS--NTDSA-PQDLYNDNIRKMKKKQHLNEAFDTLL 77
gi 82027052   1 MLTPTLIIGLIVFAFLVNKF-NSSELLVTVMVLFVLFFCILNYYYA--STESA-PQDLYNENVKKMKKKQHLNDAFDALL 76
gi 81944965   1 MSIITPVIALVVLAFLLNTAFRGSELIITILVLLVLFFCVLHIHYV--NNESG-PDTLFNEQTKKLKKKQQINDAFDAIL 77

                ....*.
gi 81981621  79 NKNTSS 84
gi 123860367 78 NKNTSS 83
gi 123852190 78 NKNTSS 83
gi 1175101   77 NKNTSS 82
gi 81961208  77 NKNTSS 82
gi 123875737 78 NKNTSS 83
gi 81968720  74 NKNNSS 79
gi 81950489  78 NKNNSL 83
gi 82027052  77 NKNNSS 82
gi 81944965  78 NKNNSS 83
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap