Conserved Protein Domain Family
Rotavirus_VP7

?
pfam05868: Rotavirus_VP7 
Rotavirus major outer capsid protein VP7
This family consists of several Rotavirus major outer capsid protein VP7 sequences. The rotavirus capsid is composed of three concentric protein layers. Proteins VP4 and VP7 comprise the outer layer. VP4 forms spikes and is the viral attachment protein. VP7 is a glycoprotein and the major constituent of the outer protein layer.
Statistics
?
PSSM-Id: 114586
View PSSM: pfam05868
Aligned: 3 rows
Threshold Bit Score: 424.296
Threshold Setting Gi: 401409
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139521     1 MASLLLLVLAAAVTAQLNIVPSTHPEVCVLYADDHQADankFNGNFTQIFHSYNSITLSFMSYSSSSYDVIDIISKYDLS 80
gi 401409     2 TTMLLLLVVAALANGQLTILPHEESQICFLQPDNPGFD---FDGNFTNIFRDYASVKISSFTYKAQDADIVEILNVDRDR 78
gi 81924778   1 MPLPLLLVFAACAKAQLVITPISNPEICVLHASDW--NvnsFGDNFTNIFETYNSVTLSFYQYDSTNYEVIDIISKRDYS 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139521    81 SCNILAIDVFNASMDFNVFLQSTNNCSKYNANKVHHVKLPRGEEWFSYSKNLKFCPLSDSLIGMYCDTQLSDTYFEISTG 160
gi 401409    79 SCTILAIYIADSTLDFNTFLQSENECVKYAASKKHYIKLPRDREYFALAKNLSFCPLNDDLIGIYCDTQLETTYFSVARS 158
gi 81924778  79 LCHILAIDVVKPEMDFITFLQSNNECTKYAGQKIHYQKLSTNEEWFVYSKNLSLSPLSDSLIGLYCDTEINGTYFPLSEN 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139521   161 GTYEVTDIPEFTQMGYTFHSSEEFYLCHRISSEAWLNYHLFYRDYDVSGVISKQVNWGNVWSGFKTFAQVLYKILDLFFN 240
gi 401409   159 SNYDVTDIPEFTELGYVFHSNDHFYICERKSEGNWIDYQLFYQNDAPLGTVSQRVNWGNVWSNVKTVAQMVYKILDIFFG 238
gi 81924778 159 EKYDVTDLPEFTEMGYVFYSNDDFYICKRINDHKWVNYHLFYREYSASGTVSRAISWDNVWTGFKTFAQVVYKILDIFFN 238

                ....*....
gi 139521   241 sKRNVEPRA 249
gi 401409   239 -KRNIEPRA 246
gi 81924778 239 nRRNFEPRA 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap