Conserved Protein Domain Family
DUF865

?
pfam05906: DUF865 
Herpesvirus-7 repeat of unknown function (DUF865)
This family consists of a series of 12 repeats of 35 amino acids in length which are found exclusively in Herpesvirus-7. The function of this family is unknown.
Statistics
?
PSSM-Id: 114618
View PSSM: pfam05906
Aligned: 2 rows
Threshold Bit Score: 57.513
Threshold Setting Gi: 81939278
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30
                ....*....|....*....|....*....|....*
gi 81939278  36 MGSHPFRQERPQPHNPLTFKPVKTTGTAVVFSAGF 70
gi 81939278 386 MGSHPFRQETPRPHNPLTFKPVKTTGTAVDFSAGF 420
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap