Conserved Protein Domain Family
Orthopox_F14

?
pfam06076: Orthopox_F14 
Orthopoxvirus F14 protein
This family consists of several short Orthopoxvirus F14 proteins. The function of this protein is unknown.
Statistics
?
PSSM-Id: 114778
View PSSM: pfam06076
Aligned: 2 rows
Threshold Bit Score: 95.5417
Threshold Setting Gi: 56404726
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 56404726  1 MKHRLYSEGLSISNDLNSIIGQQSTMDTDIEIDEDDIMELLNILTELGCDVDFDENFSDIADDILESLIEQDV 73
gi 465092    1 MKHKVYSEGLEISTDFNSIISQLSTSDMDIEIDEDNITELLNILTELGCDVDFDEDFSDITDDVLESLMEQDM 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap