Conserved Protein Domain Family
DUF999

?
pfam06198: DUF999 
Protein of unknown function (DUF999)
Family of conserved Schizosaccharomyces pombe proteins with unknown function.
Statistics
?
PSSM-Id: 114890
View PSSM: pfam06198
Aligned: 3 rows
Threshold Bit Score: 237.212
Threshold Setting Gi: 74624449
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 384952028  21 MVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRIS 100
gi 74638591   21 MVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPNGRIS 100
gi 74624449    1 MVRDTRNVDLEWGLELCKPEKVNK---------QNLFTNIIKPQKDKINIKTDKIKFFLDNLFTEFSKFHDSCYPDGRIS 71
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 384952028 101 TRSNFRWPLLIIWSIIIVFAVDKKFEVQKFLSIW-----INENRFYSEIWVPIAIYVCLLVLMLLSLI 163
gi 74638591  101 TQDKSRWVLLIIWSIITILTIDKKFKIKESYLEW-----IGENQSHSEIWGPIVIYVGLFILLLSAFN 163
gi 74624449   72 TRSKLRWPLLIIWCILIVFAIDKNFEVKDFLSIWinesfINENRFYSEIWGPIAIYICLFVLLLLGLI 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap