Conserved Protein Domain Family
DUF1030

?
pfam06270: DUF1030 
Protein of unknown function (DUF1030)
This family consists of several short Circovirus proteins of unknown function.
Statistics
?
PSSM-Id: 114962
View PSSM: pfam06270
Aligned: 2 rows
Threshold Bit Score: 67.6707
Threshold Setting Gi: 81960621
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|...
gi 81960621  9 MVFIIHLGFKWGVFKIKFSELYIHGYTDIVVLVVFTVFERSAEAYVVHISRGL 61
gi 75557087  1 MVFIIHLGFKWGVFKIKFSELYIHGYTDIVVLVVYTVFERSAEAYMVYISSSL 53
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap