Conserved Protein Domain Family
DUF1067

?
pfam06362: DUF1067 
Protein of unknown function (DUF1067)
This family consists of several hypothetical Mycobacterium leprae specific proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115044
View PSSM: pfam06362
Aligned: 2 rows
Threshold Bit Score: 134.285
Threshold Setting Gi: 75420434
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75424204   1 MTTPTPQGHDMHTKTPLPRGANNYPHTHACIDIAFSTAQVPSPWHHQHVDQAASTTDMLTCAALIVSTAAKHTKPHRKQA 80
gi 75420434   1 MTTPTPQGHDMHTKTPLPRGANNYPHTHACIDIAFSTAQVPSPWHHQHVDQAASTTDMLTCAALIVSTAAKHTKPHRKQA 80
                        90
                ....*....|....*..
gi 75424204  81 VSHPPTKTPQHSNKRFS 97
gi 75420434  81 VSHPSTKTPQHSKTRQQ 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap