Conserved Protein Domain Family
RhaT

?
pfam06379: RhaT 
L-rhamnose-proton symport protein (RhaT)
This family consists of several bacterial L-rhamnose-proton symport protein (RhaT) sequences.
Statistics
?
PSSM-Id: 115061
View PSSM: pfam06379
Aligned: 2 rows
Threshold Bit Score: 589.638
Threshold Setting Gi: 62511083
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 132529     1 MSNAITMGIFWHLIGAASAACFYAPFKQVKQWSWETMWSVGGIVSWLILPWTISALLLPDFWAYYGQFNLSTLLPVFLFG 80
gi 62511083   1 MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVSWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 132529    81 AMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPIINGNFDVLIHTEGGRMTLLGVFVALIGVGIVTRAGQLKER 160
gi 62511083  81 AMWGIGNINYGLTMRYLGMSMGIGIAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKER 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 132529   161 KMGIKAEEFNLKKGLLLAVMCGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGALVNLGFCFIRLAKVQ 240
gi 62511083 161 AMGIQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMGGGAIINLSYCFIRLATLK 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 132529   241 NLSIKADFSLARPLIISNILLSALGGLMWYLQFFFYAWGHARIPAQYDYMSWMLHMSFYVLCGGLVGLVLKEWKNAGRRP 320
gi 62511083 241 NLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHAKIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKP 320
                       330       340
                ....*....|....*....|....
gi 132529   321 VAVLSLGCVVIIIAANIVGLGMAS 344
gi 62511083 321 VAVLCIGCLVIILAANIVGLGMAA 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap