Conserved Protein Domain Family
Lamprin

?
pfam06403: Lamprin 
Lamprin
This family consists of several lamprin proteins from the Sea lamprey Petromyzon marinus. Lamprin, an insoluble non-collagen, non-elastin protein, is the major connective tissue component of the fibrillar extracellular matrix of lamprey annular cartilage. Although not generally homologous to any other protein, soluble lamprins contain a tandemly repeated peptide sequence (GGLGY) which is present in both silkmoth chorion proteins and spider dragline silk. Strong homologies to this repeat sequence are also present in several mammalian and avian elastins. It is thought that these proteins share a structural motif which promotes self-aggregation and fibril formation in proteins through interdigitation of hydrophobic side chains in beta-sheet/beta-turn structures, a motif that has been preserved in recognisable form over several hundred million years of evolution.
Statistics
?
PSSM-Id: 115083
View PSSM: pfam06403
Aligned: 2 rows
Threshold Bit Score: 44.6344
Threshold Setting Gi: 82120769
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82121112   1 MAATMQALLVIALLHLATATPVVTKHKVSTFSTGFLGHPVGGLGYGGLGYGGLGYGGLGVAGLGYGGLGYPGAALGGAYT 80
gi 82120769   1 MAAAIQALLVLALLHLATATPVIGKQTVSTLSTGYLGHPVGGLGYGGLGYGGLGVAGLGVAGLGYGGLGYPGAALGGVYT 80
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 82121112  81 HHAAglvhpygglgyhaapyhhaLGGLGYPLGIGAGVVAPHVVNSKIAAPLAPVVAAI 138
gi 82120769  81 HHAA-------------------LGGLGYPLGIGAGVVAPHVVKGKVAAPLAPVVAAI 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap