Conserved Protein Domain Family
SEF14_adhesin

?
pfam06443: SEF14_adhesin 
SEF14-like adhesin
Family of enterotoxigenic bacterial adhesins.
Statistics
?
PSSM-Id: 115120
View PSSM: pfam06443
Aligned: 2 rows
Threshold Bit Score: 226.075
Threshold Setting Gi: 462119
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75347334   2 RSKLSILIFALMTCGAANAATAVGDVATVRAPLVFSAQNTINATWTQDSSVSGSSVTAMQKLGTLNIRLTGSHAGVYVSG 81
gi 462119     3 KSASAVAVLALIACGSAHAAGFVGNKAVVQAAVTIAAQNTTSANWSQDPGFTGPAVAAGQKVGTLSITATGPHNSVSIAG 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75347334  82 DDTGESGGLITIPFKNTAGQVLFRGRTNAEIGQAMTTPIVGHSGpGWHLPGTQDNFNLDIRAFqNANNIPAGEYTATFYI 161
gi 462119    83 KGASVSGGVATVPFVDGQGQPVFRGRIQGANINDQANTGIDGLA-GWRVASSQETLNVPVTTF-GKSTLPAGTFTATFYV 160

                ....*
gi 75347334 162 QQYQS 166
gi 462119   161 QQYQN 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap