Conserved Protein Domain Family
LT-IIB

?
pfam06453: LT-IIB 
Type II heat-labile enterotoxin, B subunit (LT-IIB)
Family of B subunits from the type II heat-labile enterotoxin. The B subunits form a pentameric ring, which interacts with one A subunit. Thus, the structural arrangement of type I and type II heat-labile enterotoxins are very similar.
Statistics
?
PSSM-Id: 115129
View PSSM: pfam06453
Aligned: 2 rows
Threshold Bit Score: 240.33
Threshold Setting Gi: 1169448
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169448     1 MSFKKIIKAFVIMAALVSVQAHAGASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPD 80
gi 632173769   5 MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPD 84
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 1169448    81 NVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAE 122
gi 632173769  85 NFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap