Conserved Protein Domain Family
L_lac_phage_MSP

?
pfam06488: L_lac_phage_MSP 
Phage tail tube protein
This is a family of Siphoviridae phage tail tube proteins including several from Lactococcus lactis.
Statistics
?
PSSM-Id: 115164
View PSSM: pfam06488
Aligned: 2 rows
Threshold Bit Score: 584.768
Threshold Setting Gi: 75089521
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089521   1 MKLDYNSREIFFGNEALIVADMTKGSNGKPVFTNHKIVTGLVSVGSMEDQAETNSYPADDVPDHGVKKGATLLQGEMVFI 80
gi 75089520   1 MKLDYNSREIFFGNEALIVADMAKGSSGKPEFSNHKIVTGLVSVGSMEDQAETNSYPADDVPDHGVKKGATLLQGEMVFI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089521  81 QTDQALKEDILGQQRTENGLGWSPTGNWKTKCVQYLIKGRKRDKVTGEFVDGYRVVVYPHLTPTAEATKESETDSVDGVD 160
gi 75089520  81 QTDQALKEDILGQQRTANGLGWSPTGNWKTKCVQYLIKGRKRDKITGEFVDGYRVVVYPHLTPTAEATKESETDSVDGVD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089521 161 PIQWTLAVQATESDIYLNGDKKVPSIEYEIWGEQAKDFAKKMESGLFIIQPDTVLAGAITLVAPVIPNVTTATKGNNDGT 240
gi 75089520 161 PIQWTLAVQATDSDIYLNGDKKVPAIEYEIWGEQAKDFVKKMESGLFIMQPDTELAGEVTLVAPTLANVQTKTKGNNDGT 240
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 75089521 241 IVVPDTLKDSKGRTIKVTSVIKDAHGKVATNGQLAPGVYIVTFSADGYEDVTAGVSVTDHS 301
gi 75089520 241 IVLPATLKNSKGQDIKVTAVIKDVKGNVATNNELAPNVYIVTFSAEGYADVQAGVAVTNKP 301
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap