Conserved Protein Domain Family
Equine_IAV_S2

?
pfam06502: Equine_IAV_S2 
Equine infectious anaemia virus S2 protein
This family consists of several equine infectious anaemia virus S2 proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115174
View PSSM: pfam06502
Aligned: 2 rows
Threshold Bit Score: 114.026
Threshold Setting Gi: 82281204
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82302298  1 MGLFGKGVTWSALHSVGVSQGEYQPLSPNKQNQQTHRKEIIWyiNPIVIMIAIKKKWQRQETQDTKK 67
gi 82281204  1 MGVFGKGVTWSASHSMGESQGESQPLLPNSQKNLSVRRTQCF--NLIVIIMTVRTAWQNRRKQETKK 65
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap