Conserved Protein Domain Family
BDV_P10

?
pfam06515: BDV_P10 
Borna disease virus P10 protein
This family consists of several Borna disease virus P10 (or X) proteins. Borna disease virus (BDV) is unique among the non-segmented negative-strand RNA viruses of animals and man because it transcribes and replicates its genome in the nucleus of the infected cell. It has been suggested that the p10 protein plays a role in viral RNA synthesis or ribonucleoprotein transport.
Statistics
?
PSSM-Id: 115187
View PSSM: pfam06515
Aligned: 3 rows
Threshold Bit Score: 126.407
Threshold Setting Gi: 75569130
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81929655  1 MSSDLRLTLLELVRRLNGSATIESGRLPGGRRRSPDTTTGTIGVTKTTEDPKECTDPTSRPAPEGPQEEPLHDLRPRPAN 80
gi 81976695  1 MSSDLRLTLLELVRRLNGNTTVESGRLSGGRRRSPDTTTGAVGITKTKEDSKECTDPASGPAPEGSPEEPLHDLRSRSAN 80
gi 75569130  1 MSSDLRLTLLELVRRLNGNATIESGRLPGGRRRSPDTTTGTVGVTKTTEDPKECIDPTGRPAPEGPQEEPLHDLRPRPAN 80

               ....*..
gi 81929655 81 RKGAAVE 87
gi 81976695 81 RKGAAIE 87
gi 75569130 81 RKGAAIE 87
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap