Conserved Protein Domain Family
DUF1106

?
pfam06523: DUF1106 
Protein of unknown function (DUF1106)
This family consists of several hypothetical bacterial proteins found in Escherichia coli and Citrobacter rodentium. The function of this family is unknown.
Statistics
?
PSSM-Id: 115195
View PSSM: pfam06523
Aligned: 2 rows
Threshold Bit Score: 179.054
Threshold Setting Gi: 75407612
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75344003   1 MASLWKRLFYSSGRRRRYFEEGEHSFSILCGRLRGIVLTIKCSNGIIYLSIKVSPNNRNHVFLYHKKDYVFDKLKEIFPD 80
gi 75407612  13 MASLWKKLFYFPGNRRRYFEQEEHSFSIICGRLRGIVVTFKCSKGIIYLSIKVNPNNSKHILLYNKKEYIFDKLKELFPD 92
                        90
                ....*....|.
gi 75344003  81 EAIEFTIEYEN 91
gi 75407612  93 EAIEFSIEYEN 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap