Conserved Protein Domain Family
PerB

?
pfam06590: PerB 
PerB protein
This family consists of several PerB or BfpV proteins found specifically in Escherichia coli. PerB is thought to play a role in regulating the expression of BfpA.
Statistics
?
PSSM-Id: 115260
View PSSM: pfam06590
Aligned: 2 rows
Threshold Bit Score: 247.653
Threshold Setting Gi: 75411702
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75411578   1 MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVFFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYS 80
gi 75411702   1 MKNNLREEKEVVIDGCINVLSLPSEWKAITPKKNNVTSEIIVFFIPPKASYHIILKYDNTKHCELFFSDHITGEQDVIYS 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
gi 75411578  81 QNAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP 129
gi 75411702  81 QSAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap