Conserved Protein Domain Family
SepQ

?
pfam06622: SepQ 
SepQ protein
This family consists of several enterobacterial SepQ proteins from Escherichia coli and Citrobacter rodentium. The function of this family is unclear.
Statistics
?
PSSM-Id: 115292
View PSSM: pfam06622
Aligned: 2 rows
Threshold Bit Score: 638.235
Threshold Setting Gi: 75407611
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75407611    1 MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEGCFWVSEEQLTQWCHELFPYS 80
gi 446973540   1 MNLLNSQLNMKINDFYLPLLSVIGTGRLYITPEGHACHAYFREVSGNGIRFTLTCSGYEGRFWISEEQFIQWCQELFPYS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75407611   81 DSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKDIYPVIENNNGKNRLNVIILKTTVQSLQYLINDNWQLVPHS 160
gi 446973540  81 ESRLIPEDMIKLMILWVMQTALPEGDVSVDDVQFTMLNKDVYPVIENNNGENRLNVIILEITVQSLQYLINENWQFVPHS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75407611  161 NTLFFDGYIAPGWTDYPITKLSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNR 240
gi 446973540 161 NTIFFDGYIAPGWTDYPVTELTVGDSLRLYHVDDSKERECWLVINNPLATVKLCDNNLFIADVQAADLLCTISNEAVMDR 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 75407611  241 IYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYSNISVVCD 305
gi 446973540 241 IYCVIGTIHVDIHMLRNAKKDDIIDSTGYHLFGGCRLIRNNTTIAYGSIVKINEDFYFTVSLVCD 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap