Conserved Protein Domain Family
DUF1155

?
pfam06633: DUF1155 
Protein of unknown function (DUF1155)
This family consists of several Cucumber mosaic virus ORF IIB proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115303
View PSSM: pfam06633
Aligned: 2 rows
Threshold Bit Score: 78.2527
Threshold Setting Gi: 75570083
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|..
gi 75570083  1 MSATLSTTLSFEPPLSLLAEPGTWFADTMDFRKKHSVRWYES 42
gi 81945560  1 MSATLSTTLSFEPPLSLLAEPGTWFADTMDFERNTLLGGMSH 42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap