Conserved Protein Domain Family
NolV

?
pfam06635: NolV 
Nodulation protein NolV
This family consists of several nodulation protein NolV sequences from different Rhizobium species. The function of this family is unclear.
Statistics
?
PSSM-Id: 115305
View PSSM: pfam06635
Aligned: 2 rows
Threshold Bit Score: 364.737
Threshold Setting Gi: 499397156
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81777571    1 MTADISVAPAAPQMRPLGPLIPASELEIWDNAAKACAAAERHQQHVRSWARAAYQRELARGHTEGLNAGAEEMAALISQA 80
gi 499397156   1 MTADALAPPAAPKIRALGPLIPAAQLEIWHDAIQALAAAERHLQRVRGWARLAYERERAQGRAEGAKAGAEEMARLIAQA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81777571   81 VAEVARRKAVLEQQLPQLVLEILSELLGAFDPGELLVMAVRHAIERQYSGAEVCLHVYPTQVDMLAREFAGWDGQDGRPR 160
gi 499397156  81 TCELAQRKAVLERELPQLVFEIVRDLLGAFDSGKMLVQCVRHAIEQRYKNTEVCLHVSPLKADLLASEFKDYDGLEGRPK 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 81777571  161 VRIKPDPTLSPRRCVLWSEYGNVDLGLDAQMRALRLGFGsLSEKGEL 207
gi 499397156 161 LRIEADPALSADQCVLWSEFGNVDLGLAAQLRALRLGFG-LTEEAES 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap