Conserved Protein Domain Family
L_lactis_ph-MCP

?
pfam06673: L_lactis_ph-MCP 
Lactococcus lactis bacteriophage major capsid protein
This family consists of several Lactococcus lactis bacteriophage major capsid proteins.
Statistics
?
PSSM-Id: 115336
View PSSM: pfam06673
Aligned: 2 rows
Threshold Bit Score: 622.177
Threshold Setting Gi: 75089519
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089517   1 MGVNETQEMMKQAIEAGVKVRELETKVEELNKEREELKKEREANIPSEKPQDVERKFMRELGDKMTEMPEQGFLREFANA 80
gi 75089519   1 MGANETQEIMKQAIEAGVKVRELEAKVEELNKEREELKKEREASIPSEKPEDAERKFMRELGSKMAEMPEQGFLREFANG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089517  81 SALNVVNSLGSITSKYARKSGIYDGAMKARFQGLTLAEDGVDDTFIEGTFKAGTDKNKAQTASKRSLRPQMAEAYLQMDK 160
gi 75089519  81 ADLNVVNSLGSITSKYARKSGIYDGAMKARFQGLTLAEDGVDDTFISGTFKAGTDKNKSQTATKRSLRPQMAEAYLQMDK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089517 161 ATVRGVNDSGALSEYVMSEMVNRVIQKVEHNMILGSADGSNGFYGLKTATDGWTKQIEYTDLFDGITDAVAECSISDAIT 240
gi 75089519 161 ATVRGVNDSGALSEYVMSEMVNRVIQKVEYNMILGSVDGSNGFYGLKTATDGWTKQIEYTDLFEGITDAVAECSISDAIT 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75089517 241 IVMSPQTFAELRKAKGTDGHSRFNELATKEQIAQSFGAVNLETRVWMPKDEVAVYNHDEYVLIGDLNVENYNDFDLRYNV 320
gi 75089519 241 IVMSPQTFAELRKAKGTDGHSRFNELATKEQIAQSFGAVNLETRVWMPKDEVAVYNHDEYVLIGDLNVENYNDFDLRYNV 320
                       330       340
                ....*....|....*....|....*..
gi 75089517 321 EQWLSETLVGGSIRGKNRSAYLTKKAS 347
gi 75089519 321 EQWLSETLVGGSIRGKNRSAYLKKKGS 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap