Conserved Protein Domain Family
DUF1187

?
pfam06688: DUF1187 
Protein of unknown function (DUF1187)
This family consists of several short, hypothetical bacterial proteins of around 62 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi. The function of this family is unknown.
Statistics
?
PSSM-Id: 115351
View PSSM: pfam06688
Aligned: 2 rows
Threshold Bit Score: 101.297
Threshold Setting Gi: 12515405
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 12515405  26 YKITATIEKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQSS 86
gi 920358197  4 YQINATIKKPGGGPVKWTHYSDFPMTAEECRKNFSKEKEAGKCFSVDVHISDFICKEIPPQ 64
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap