Conserved Protein Domain Family
MNSV_P7B

?
pfam06692: MNSV_P7B 
Melon necrotic spot virus P7B protein
This family consists of several Melon necrotic spot virus (MNSV) P7B proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115355
View PSSM: pfam06692
Aligned: 2 rows
Threshold Bit Score: 106.657
Threshold Setting Gi: 81949547
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 81958719  68 MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDNSSVKTQYVGISTNGDG 128
gi 81949547   1 MACYHCDSSPGDYSGALLILFISFVLFCITSLSPQGNTYVHHFDNSSIKTQYVGISTNGDG 61
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap