Conserved Protein Domain Family
BALF1

?
pfam06861: BALF1 
BALF1 protein
This family consists of several BALF1 proteins which seem to be specific to the Lymphocryptoviruses. BALF1, inhibits the antiapoptotic activity of EBV BHRF1 and of KSBcl-2.
Statistics
?
PSSM-Id: 115513
View PSSM: pfam06861
Aligned: 2 rows
Threshold Bit Score: 299.623
Threshold Setting Gi: 81966167
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81962398   1 MrpaksTDSVFVRTpveawvAPS-PPDDKVAESSYLMFRAMYAVFTQDE-TGLPLPAMVLCRLIKASLKKDKKLYAELAC 78
gi 81966167   1 M-----TDDVFQDN------APNlGAEDEMDRGVLLLTRVMIAAYLDDPgKGLGTEERLFLRLIKRLMKKEEKRFADIVN 69
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81962398  79 KTADIGGKHAHVQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHESAAFVLGAIAHYLALYRRLWFARMGGM 158
gi 81966167  70 SGSAPTTLHGHIKRLMTFTRAIYEDHMDNWFRVRALTSLAVAYARRNIPGDSENAGLLLVGFAEFLCLYRRAWLSRLGGI 149
                       170       180
                ....*....|....*....|....
gi 81962398 159 PRSLRRQFPVRWALAGLTYFLKSL 182
gi 81966167 150 RVGLRRAFPLTWMRMRVGESCYKQ 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap