Conserved Protein Domain Family
PRF

?
pfam06875: PRF 
Plethodontid receptivity factor PRF
This family consists of several plethodontid receptivity factor (PRF) proteins which seem to be specific to Plethodon jordani (Jordan's salamander). PRF is a courtship pheromone produced by males increase female receptivity.
Statistics
?
PSSM-Id: 115526
View PSSM: pfam06875
Aligned: 2 rows
Threshold Bit Score: 384.868
Threshold Setting Gi: 82124696
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82124696   2 RSTSLLTFLVVSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSADSLLPTYLSFQGAPLSDPDYQLPHIKVV 81
gi 82124692   2 RSTSLLTFLVVSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSADSLLPTYLSFQGAPLSDPDYQLPHIKVA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82124696  82 NLPTAAMDYDTFIRQTDETRLKNNLYFYSAIVEFLKEAMTEQEDLNPAELALKAKFEEAMANSNTLISKISDIMTQMGMS 161
gi 82124692  82 NLPTAAMDYDTFMKQTDETRLNNNLYFYSAIVEFLKEAMTEQEDLNPAELSLKAKFEEAMANSNTLISKISDIMTQMGMS 161
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 82124696 162 VTITLPKPLVVPFKGSAYFSKKLRGGVVCKEYKERVFLTKRDFMLLAEKYQGPL 215
gi 82124692 162 VTITLPKPLVVPFEGSAYFRKKLRGGVVCKEYKERVLLTKRDFEFLAKKYQGHL 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap