Conserved Protein Domain Family
CTV_P13

?
pfam06922: CTV_P13 
Citrus tristeza virus P13 protein
This family consists of several Citrus tristeza virus (CTV) P13 13-kDa proteins. Citrus tristeza virus (CTV), a member of the closterovirus group, is one of the more complex single-stranded RNA viruses. The function of this family is unknown.
Statistics
?
PSSM-Id: 115570
View PSSM: pfam06922
Aligned: 3 rows
Threshold Bit Score: 225.654
Threshold Setting Gi: 81981715
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81981715   1 MSIRRVWLKVIAVITVLWYCKEPSISEGYNALMNDDFKFIDTHFSNVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESR 80
gi 81936115   1 MSIRRSWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFTNVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESR 80
gi 81968536   1 MGIRRVWLKIMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFSNVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESR 80
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 81981715  81 SDRTNVSEIVESHVSDRDRMHILLRNKRIQIPSLLPCDN 119
gi 81936115  81 ADRTNVSEIVESHVSDRDRMSILLRNKRIQIPSLLPCDN 119
gi 81968536  81 ADRANVSEIVESHVSDRDRMKILLRNKRIQIPSLLPCDN 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap