Conserved Protein Domain Family
SSP160

?
pfam06933: SSP160 
Special lobe-specific silk protein SSP160
This family consists of several special lobe-specific silk protein SSP160 sequences which appear to be specific to Chironomus (Midge) species.
Statistics
?
PSSM-Id: 115579
View PSSM: pfam06933
Aligned: 2 rows
Threshold Bit Score: 1093.66
Threshold Setting Gi: 74763818
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818   1 MNIKVILVCALVAIFFAQVAEGGPIANFVGFVISLLFSLFEVMVSVVFDVKSFTSLSTPTCNSTVPSFATRVGGGRFSGI 80
gi 74763816   1 MNIKVILVCALVAIFFAQVAEGGPIANFVGFIISLLFSLFEVMLSVVFDVKSFTSLSNATANATMPGFASSVGGGRFTVI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818  81 ITASFNMIAMISANVQAIQSGSGSTSGSSSSSTTSTSNSTTTTSNSTTTTTNSTTttsnstsSSNSTSSGLTSSASVVSL 160
gi 74763816  81 MKGTFNLIAMISANIQAIQSGSGSASSNSSSSANSTTSSNSTTSSNSTTSSNSTT-------SSNSTSSGLTTGASVVSL 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 161 IDTIAWVYQDSSVGIAYLMVSILALFYGQSVSAPPYPDLGIPALPANCSGPGVPQSVQIRAAIAYVNITIYFINMTGQQF 240
gi 74763816 154 IDTCAWVYQDSSVGIAYLMVSILALFYGQSVSAPPYADLGIPALPANTSGAGVPQSVQIKAAITYINVTINFITLTGQQF 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 241 EDLQGPVATDCGCPNTTSVAPLVLEWEAILAALQALANSTASANSTTSSNSTTTTTTNSTSTTTTNSTTTTNSTSSSNSS 320
gi 74763816 234 EDLQGPVTTDCGCPNTTSVAPLVAEWEAIMAALEAFASGSASSNSTSNSTSTSNSTTTSNSTTTTNSTTSTNSTSSSNST 313
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 321 TIAGCIDISANFTIALQSLQALLLQESTCAPALAANAKKSGVRDMSPCKPGktASGCAKSGEKKVKRKARLEKMRAKCRR 400
gi 74763816 314 TIAGSIDIAANLTVALQNLQALLMQEATCAPCLAANAKKSGVREFGPCKAA--GSSCARSGQRKVKRKARLEKMRAKSRR 391
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 401 AVGNRmKGSMKKRVRSRAKKFGEAAKSGVRRYRKNIKYVYIPPVMASLNAYAALMASLSESISSQSDSALNSTDQACNST 480
gi 74763816 392 AVGNR-KGSMKKRVRSRAKKFGKAAKSGVRRYRKNIKFVYIPPVMASLNAYAALMASLSDSISYQSESALNSTDSACNST 470
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 481 GSNTDAAVIAATNNVTDMFANFTAMVLNNTVAYPNCTQFADMALLMISQINDQIISCGSQSDDAESSIYFNVTINIVAMA 560
gi 74763816 471 SNSTDEAVINATTAVTDMFVNFTAMVINNTVAHPNCTQYADMALSMVSQINEQIIACGSQSDSAQSSIYANVTISIVAMA 550
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 561 QEYNNFASMSDKCTRSFANSWLWMYIKWVFYRMGMTSGIPNFLACQTKAESSLTALLASFNATINATIAAASANSSSVQS 640
gi 74763816 551 QEYNNFASMSDKCTRSFANSWLWMYIKWVFYRMGMTSGVPNFLACQTKAQSSLTAFLASFNATVSATISAASANNSEVQS 630
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74763818 641 SEASCIESSLSDASAILAMYENAYQNCVAPGSV--PDAANTTTTSTTTTTTTTTTAAPTTTTTKAANAPFTYPLCNLQMT 718
gi 74763816 631 SEAACIESSLAEAAVILEMFEAAYQNCTDPGSVtvPAETTTTTSTTTTTTTTTTTAAPTTTTTKAANAPFTYPLCTLIMS 710
                       730       740       750
                ....*....|....*....|....*....|....*...
gi 74763818 719 AACVAGLPTCTYPFISSAGCCPSGKTLNTGLGGRGCCK 756
gi 74763816 711 TTCSLGGAGCTYPLISSAGCCPSGKTLNTGLGGRGCCK 748
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap