Conserved Protein Domain Family
TrfA

?
pfam07042: TrfA 
TrfA protein
This family consists of several bacterial TrfA proteins. The trfA operon of broad-host-range IncP plasmids is essential to activate the origin of vegetative replication in diverse species. The trfA operon encodes two ORFs. The first ORF is highly conserved and encodes a putative single-stranded DNA binding protein (Ssb). The second, trfA, contains two translational starts as in the IncP alpha plasmids, generating related polypeptides of 406 (TrfA1) and 282 (TrfA2) amino acids. TrfA2 is very similar to the IncP alpha product, whereas the N-terminal region of TrfA1 shows very little similarity to the equivalent region of IncP alpha TrfA1. This region has been implicated in the ability of IncP alpha plasmids to replicate efficiently in Pseudomonas aeruginosa.
Statistics
?
PSSM-Id: 115680
View PSSM: pfam07042
Aligned: 2 rows
Threshold Bit Score: 615.885
Threshold Setting Gi: 45862269
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75427535 126 KKRTAGGELAEKVSEAKQTALLKHTKQQIKDMQLSLFDLAPWTGSHAALPNDFGRSAIFTVRNKKVPRPALQGQSIYHVN 205
gi 45862269 112 KRKTAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTRNKKIPREALQNKVIFHVN 191
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75427535 206 KDVEITYTGIELRADDDELVFAQVLEYANGTALGEPVSFTFYELCQDLDWSINGRYYTRAEECLTRLQASAMQFSSQRIG 285
gi 45862269 192 KDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTFYELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVG 271
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75427535 286 RLESVSLIRRFRVLDRGKRTSRCQVEIDAEIVVLFAGDHYTKFVWEKYRKLSPNrDGRMFDYFATHKEPYPLKLETFRLM 365
gi 45862269 272 HLESVSLLHRFRVLDRGKKTSRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPT-ARRMFDYFSSHREPYPLKLETFRLM 350
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 75427535 366 CGSDSTRPKKWREQVGEACDELRENGLVESAWVNDDLVHCKR 407
gi 45862269 351 CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap