Conserved Protein Domain Family
DUF1331

?
pfam07048: DUF1331 
Protein of unknown function (DUF1331)
This family consists of several Circovirus proteins of around 35 residues in length. Members of this family are described as ORF-10 proteins and their function is unknown.
Statistics
?
PSSM-Id: 115686
View PSSM: pfam07048
Aligned: 3 rows
Threshold Bit Score: 46.97
Threshold Setting Gi: 81962329
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|....*
gi 81982067  1 MSTAQEGVLTVVALTVYPKVRERRALKMPFFLFQR 35
gi 81982033  1 MSTAQEGVVTVVALTVYPKVRERRVLKMPFFLLQR 35
gi 81962329  1 MSTAQEGVLTVVFLTVYPKVRERRVLKMPFFLLQR 35
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap