Conserved Protein Domain Family
DUF1340

?
pfam07067: DUF1340 
Protein of unknown function (DUF1340)
This family consists of several hypothetical Streptococcus thermophilus bacteriophage proteins of around 235 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 115703
View PSSM: pfam07067
Aligned: 3 rows
Threshold Bit Score: 463.702
Threshold Setting Gi: 75090014
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75092876   1 MSgKYNYAGLTKELHQRLVFEFNALKEKHPRTFTHHIMKTKQCNRQYARKYCQRFDKVIKERSKLSFSTLDDMSEYLTEG 80
gi 75090014   1 MK-RFEYAGLTKELHQRLVVEFSALKEQYSRAFTKHIMETKQCDRLQARKYFQRFDNVIKERSKLSPATLDDMREYITDG 79
gi 75089568   1 MSgKYKYAGLTKELHQRLTLEFDALREEHRRTLTKYIMETKKCNRTEARKYFQRFDNVVKERSKLSPVTLEDMREYLTNC 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75092876  81 LVNDLQEYLSEHYSAPRWSCKTDSDKTNAGLTEELFLQYRNEIQELRAAHPNCFANYIMEVKGCSNQQAKTICTAINTIY 160
gi 75090014  80 LANDLENYLSKHCFSSSVKCRPDTYKRNAGLPEELFKQYCEEIKSLKAKYPNSFTAYIMDVKGCKYQKANSIRTAINTIY 159
gi 75089568  81 LVNDLQEHLLENYSARSGSCKPDTNKTNAGLTKELFREFRKEIEVLRAAHPNRNAEYIMEVKGCSKHQAHTILTAINTVY 160
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 75092876 161 TEIGILTPRKVVQLEGLLSRELFGKIAKHVFNKYEWPESLDSEVDRIYLEYRTKGDLGLEKESVKRALYKAIYMGL 236
gi 75090014 160 TEIGIMTPRKVIQLEGLLSRELFGKIAKYVFNKYEWPESLDEEVNRIFLEYRTKGNLGSDKESVKRALYKAIYMGL 235
gi 75089568 161 TEIGILTPRKVIQLEGLLSRELFGKIAKYVFNKYEWPESLDSEVDRIYLEYRTKGDLGLEKESVKRVLYKAISMGL 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap