Conserved Protein Domain Family
DUF1350

?
pfam07082: DUF1350 
Protein of unknown function (DUF1350)
This family consists of several hypothetical proteins from both cyanobacteria and plants. Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis.
Statistics
?
PSSM-Id: 115718
View PSSM: pfam07082
Aligned: 3 rows
Threshold Bit Score: 463.557
Threshold Setting Gi: 81670551
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81670551   2 EWREISGSWVLVPPQPIAVVHFLGGAFVGTAPNVAYRWLLTELGKAGYVVVATPFVNTFDHQAIARSVLNRFEIILERLQ 81
gi 81742231   2 EWQEVRGNWLCIPQRPLGWIHFLGGAFVAAAPQLTYRRLLEHLAEANYGIIATPFVNSFDHGAIALDALNKLDYALDWLV 81
gi 81772608   2 DWKEIRGNWVLVPRNPVGIIHFLGGAFVATAPHLTYRWLLEQLGNKGYVVIATPFVNTLDHIAIANSVLLNFERTIERLH 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81670551  82 KQGEITTGlLPVYGLGHSLGCKLHLLIGSLYEVERAGNILVAFNNYPVKQAIPFgeqlaqlqLDKFLTGvqkqlrqlnlq 161
gi 81742231  82 HRQGYPPA-LPIYGLGHSMGCKLHLLINSLYDGDRAGNMFMAFNNYPASQSIPW--------MDNLGPA----------- 141
gi 81772608  82 DSGALRKLyLPTYGIGHSMGCKLHLLIGSLFPVERAGNILISFNNYAAKDAIPL--------VEQFNTTl---------- 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81670551 162 vdlNFEFTPSPEETNLLIAENYRVRRNLLIKFSNDDIDQTLGLRPILNQQTADLVAYCPLPGNHLTPLGQDIQWETGQEF 241
gi 81742231 142 ---SVEFTPSPTETEHFIQKRYPVRRNLLIRFQDDDIDQTARLRSLLRAKFGDMVTALKLPGNHLTPLSQDLKWQVGAEF 218
gi 81772608 144 ---AIEFTPSPLETNKLVQESYNVRRNLLIKFNNDNLDQSAALTKILQVRFPEMVTAQTLPGTHTTPLGQDVKWQTGSSF 220
                       250       260       270
                ....*....|....*....|....*....|.
gi 81670551 242 SPLDAVGQWLKNSLSQDLRRLQKEILRWLEP 272
gi 81742231 219 SPLDALGQWIKQSLFPEMPVLEACLLEWLNP 249
gi 81772608 221 TPFDALGQWFKQEVYRDLNQLNRAMLLWLNP 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap