Conserved Protein Domain Family
Orthoreo_P10

?
pfam07204: Orthoreo_P10 
Orthoreovirus membrane fusion protein p10
This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction.
Statistics
?
PSSM-Id: 115833
View PSSM: pfam07204
Aligned: 3 rows
Threshold Bit Score: 143.144
Threshold Setting Gi: 75568258
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75568258  1 MFSMSSGSCNGATSIFGNVHCQAAQNTAGGDLQATSSLIAYWPYLAHGGGLIIIIIIvICLVCCCRAKVKRDATRSVFYR 80
gi 81920283  1 MLRMPPGSCNGATAVFGNVHCQAAQNTAGGDLQATSSIIAYWPYLAAGGGFLLIVII-FALLYCCKAKVKADAARSVFHR 79
gi 81973736  1 M----SSDCAKIVSVFGSVHCQSSKNSAGGDLQATSVFTTYWPHFAIGGGIIVVILL-LGLFYCCYLKWKTSQVKHTYRR 75
                       90       100
               ....*....|....*....|
gi 75568258 81 ELLTLNSGKCNAAPPSYD-V 99
gi 81920283 80 ELVALSSGKHNAMAPPYD-V 98
gi 81973736 76 ELIALTRSHVHSTPSGISyV 95
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap