Conserved Protein Domain Family
DUF1420

?
pfam07220: DUF1420 
Protein of unknown function (DUF1420)
This family consists of several hypothetical putative lipoproteins which seem to be found specifically in the bacterium Leptospira interrogans. Members of this family are typically around 670 resides in length and their function is unknown.
Statistics
?
PSSM-Id: 115849
View PSSM: pfam07220
Aligned: 2 rows
Threshold Bit Score: 1084.18
Threshold Setting Gi: 75405447
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447    1 MKFGLDANITYPPLSVIYSILLILGCDFLGFYILKLFENHLGEIKNTWRRWQAPLTGALLLSVSLYPLALFGFTSRLFME 80
gi 289450975   4 MKFGLDANVAYPPLSVLYSIFLIFGCDFLGFYILKLFESSLGKVKNTWIRWQAPLIGALLLSVILYPLALSALTPRFLMK 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447   81 SVAFLLVILGLINLGGFIKKIKSNKDILNISKqNLDRSLNFNIQTDL----EQQKRPFFLFKEKYSFMDKFALIDINKFL 156
gi 289450975  84 SAAIFLSVLGCANICFFVKNGTKNLVSISYYS-NIFKSIQYHSFFEKigndKKIKKSFSLFKLIGFIKNKFNLINKNDVL 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447  157 NLFIKLLLVAYGLLALCPVTNADSLDYHIGVAIEILNQGKMPAFLGWFHGRLAGSGEVLNALGLAIGAEQFGSLLQFSGL 236
gi 289450975 163 NVFIILLMIGYGFLALCPITNADSLDYHIGVAIEILNQGKMPVFSGWFHGRLAGSGEVLNALGLAIGAEQFGSLLQFCGL 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447  237 LGIYGILAFYSFLEKNLANDGsVWREIIIIAFLSSPVLVFLVSSSKPQLLQVGMTSFAVVLLLEIISKAKTDKNKLSIFI 316
gi 289450975 243 LSIYGILSFYSFAEKFSESDG-VWRKIIIIAFLSSPVLVFLVSSPKPQLLQIGMTSFAITLLLEIFSKIKTDKNKLFAFS 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447  317 LICILIMSTTQAKFSFFLSAFLIGLCSLILLGSIRLYIYGVLIGIFFLILIIFPSVFWKIKNFDSSMIDAILVPLPG-PW 395
gi 289450975 322 LICILIMSATQAKFSFFLSAFLIGLFSIFSLGSIRLFFYGLLISLFFFVLINFPAIFWKIKNYNSTFIDVLIHPLPGnTF 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447  396 PGVRSFESVLRNYRDSTLDFPLSLLIPNTFGVVTTIIGSGLFLVIFVKPIANLQTFVLSFIIIIFVILGILLGQNASRFF 475
gi 289450975 402 PGVNEFEVSLRNYQDSALIFPLSLIFPNQFGVITTVIGLGLFLIIFVKPIVTQKAFLLSVMIILFVILGSLMGQKASRFF 481
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447  476 LEPFIWILISLIVIDPIKIQNLKFTRNVIGFLVILQAGLTFGILLLGIYQLLPGVFSIQSREKVMNQYSNGYNLMKWTGS 555
gi 289450975 482 LEPFVWMLISLIGLNSFGKWNIRFVKEAVSTGILLQACATLVIISVGIYQLFPGVFSISLREKVMSQYANGYSLMKWVGL 561
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75405447  556 VLPKDAVLLSQHRSVALSERKTLSLDWAKFVNFDSIIASPYLREIKDENVTHILILGEISKDSPFFGCIGNVIGKTKSQI 635
gi 289450975 562 TLPKEAVLLSQHRSIALSERKTLSLDWIPFVDFNSAVASPYLKQIKDENVTHILMFGDTSKNTPFSGCIGNTIGKTKSNQ 641
                        650       660       670
                 ....*....|....*....|....*....|..
gi 75405447  636 AMRNPLAPKDHFTAILAEFRINNLSQCSNSVL 667
gi 289450975 642 VARNPFNRNDFFTVILVEFQSDKLPQCANFIL 673
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap