Conserved Protein Domain Family
DUF1473

?
pfam07341: DUF1473 
Protein of unknown function (DUF1473)
This family consists of several hypothetical bacterial proteins of around 150 residues in length. Members of this family seem to be found exclusively in Borrelia burgdorferi (Lyme disease spirochete). The function of this family is unknown.
Statistics
?
PSSM-Id: 115964
View PSSM: pfam07341
Aligned: 2 rows
Threshold Bit Score: 216.426
Threshold Setting Gi: 75362603
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81626239   1 MRYKLKILTRAKTHKYVLKDIPMYEWDNVLGFdVERDElINKLNDLKTLKEITKLMISRGFLDEFYEILNKERRYSELYK 80
gi 75362603   3 MRYKMKILTKNKTYEYPLKVLPVYEWDRVLGF-NQSDA-VLKLNEVQYLREITSLMISPKFLDEFYVILDQNREFISYYK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81626239  81 YALPIILFLVQYSLFQTIEGFKKPGLVYIESFQDRNGDYIKYDYIDERWSYDFLITSSKSLGLNQedsleanlepllKEG 160
gi 75362603  81 DYLVAIIYTAQFNTFHLDNDLKKPALVYLSEYENNVGDFVTFDYINENFEYEKVATSLSSSTSNS------------NEL 148

                ...
gi 81626239 161 VNE 163
gi 75362603 149 VAK 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap