Conserved Protein Domain Family
Sp38

?
pfam07354: Sp38 
Zona-pellucida-binding protein (Sp38)
This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90-kDa family of zona pellucida glycoproteins in a calcium-dependent manner. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur.
Statistics
?
PSSM-Id: 115977
View PSSM: pfam07354
Aligned: 5 rows
Threshold Bit Score: 456.215
Threshold Setting Gi: 54036630
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54036623  55 MDIDRASKETVDPIYLWIGPNENTLTGSSQINITNIGELVLKDFMESLSGHYSCTLSYKIVKAETQEETSLKKKYDFLVF 134
gi 54036632  56 MDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVF 135
gi 54036629  79 MDLSLSQEEIIDPKYSWTGPDGRNLEGRGYANLTGSGELMLVGFQESMSGAYTCTLSHRIIETSAQEEVDVRDTYRFMVY 158
gi 54036622  86 VTQRLRNFELVDPSFQWHGPKGKIVSENSTAQVTSTGSLVFQNFEESMSGVYTCFLEYKP----TVEEVVKNLQLKYIIY 161
gi 54036630  58 VTNRLRNSELIDPVFRWNGPSGYLSSANSSVQISPTGTLILGHFRSDLSGVYTCSLVYKLIAAQPD----KRLTIKYHIY 133
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54036623 135 AYREPDYSYRMAVRFTTKSCVGRYNDLLFRLLKKILDNLISDLLCHVIEPSYKCHSVKIPERDFVYELFVAFQVNPFAPG 214
gi 54036632 136 AYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPG 215
gi 54036629 159 AYREANHVYQVSVRFTAKGCELAANARFVEELKKIMESLISDLTCGVKGPSYRCHSLEAPHRGSPSELFITFQVNPFAPG 238
gi 54036622 162 AYREPRYYYQFTARYHAAPCNSIYNISFEKKLLQILSKLVLDLSCEVSLLKSECHRVKMQRAGLQNELFFTFSVSSLDTE 241
gi 54036630 134 AYSDPQYYYELTVQYHAAPCNSFHNTSFGRALLQILSKLVADLSCEVSLIKSECHHVKMQRGGLQSEMFFKFSVTCLDTE 213
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54036623 215 WKSMCNS-SMDCEDVTNHNILKARDRIEEFFRSQAYILHHHFNItVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCAS 293
gi 54036632 216 WKGACNG-SVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKtLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCAS 294
gi 54036629 239 WEDLCSRlPQDCEDTTNRRAQEATERIGEFFRKQTYALKHQFQT-VPTIHYVEGSFSVTPIDSCRPGFGRNNITHRSCAG 317
gi 54036622 242 KGPKPCA-GHSCESSKR--LSKAKNLIERFFNQQVEVLGRRAEP-LPEIYYIEGTLQMVWINRCFPGYGMNILKHPKCPE 317
gi 54036630 214 NNKLCRQ-SA-CDKPHR--LHKAKDLIERFFKREVEIRKKSTEP-LPEIYYIEGTLQMVWVDRCYPGYGINAVRHPDCPE 288
                       250       260       270
                ....*....|....*....|....*....|....*
gi 54036623 294 CCVVCSPGTFSPDMDVTCQTCVSAHV--YGAKACP 326
gi 54036632 295 CCVVCSPATFSPDVNVTCQTCVSVLT--YGAKSCP 327
gi 54036629 318 CCVVCSPGTYSPDSAGSCRVCAGRRTagYGAKSCP 352
gi 54036622 318 CCVICSPGTYNSRDGIHCLQCNSSLV--FGAKACL 350
gi 54036630 289 CCVICSPRSYNPSNGIHCLQCDTSLI--YGATTC- 320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap