Conserved Protein Domain Family
DRIM

?
pfam07539: DRIM 
Down-regulated in metastasis
These eukaryotic proteins include DRIM (Down-Regulated In Metastasis), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells. It is believed to be involved in processing of non-coding RNA.
Statistics
?
PSSM-Id: 311475
View PSSM: pfam07539
Aligned: 147 rows
Threshold Bit Score: 319.102
Threshold Setting Gi: 358332538
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054   841 ATQKILIAYLNIFAKVKNPKTIFKSEKLYELFEELLTHRSFEVQKLALDCIFTYNNAAITPYKDNLYRLSSEKTMKDEMQ 920
gi 972982186   798 AAAKQLIAHLKVFSLFANPRSLYLEPKLRELYTRLLSHQDQGIQKIALECILTYKDSFLLPYKENLQRLLDDKLFKEEIV 877
gi 156361147   892 AATKSLCAHLNLFGLFHNPRALAKETQVRKIYLSMLTHRDPAVQKLAVACLLTYKFPYMEPYRDHVNKLLEDESFRDELA 971
gi 260788714   748 aasrsLVVHLTLFSKFKSPRSLYLEPRLKELYFEMLKHREQDVQRAALACLMTYKAPYLTPYSDNLDRLLQDKEFREELT 827
gi 1005965770  916 vmLKTMVAFLDLLAQFKAPKKLDKGGKLLELHRSLLQHTNPIVQKAALNCLFNYNDKNVNPYRESLFRLLDDTTFKDEIL 995
gi 198420489   828 dSVKMLISMLNVFANLNNPSSTIQKDKLLSLFKDLLTHVHTDMQQAALKCLYQYKWKGLTKHKEKICEFFDDKLFRDALT 907
gi 768944429   917 iAAKQLITHLKVFSKFLNPRSLYLESSLSELYNQLLCHQDQNIQRVALECVLTYRDPNIVPYKENLERLLQDKHFKEEIV 996
gi 765159049   765 AAAKQLITHLKVFAKFTNPRALYLESSLSDLYHQLLCHQDQQIQRAALECLFTYKDPNVLPYKENLERLLDDKHFKEEIV 844
gi 542225145   926 ATAKQLIAHLKVFAKFTNPRALYLESSLHELYNQLLTHQDQQIQQVALECVITYKDPNIVPYKENLERLLDDKHFKEEIV 1005
gi 597778293   918 AAAKQLIAHLKVFSKFSNPRALYLEPDLHNLYTQLLCHKDQQIQKAALDCMMTYKDQDIVPYKENLERLLDDRHFKDEIV 997
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054   921 SFFKEdpendsrlrcV---------VVPLVMKIVHTRMVQKVTpt--------eLKALLLRFVgnfHENEINLFISMSFA 983
gi 972982186   878 HFNISee-------cAvveaphrpgLMPVLMRILYGRMRSKTGsrsqgkagavtRTSIVLRFLagsLPEEIGMFIDLLLE 950
gi 156361147   972 LFTVDdg-------mAvvdpahreeLMPIVIRILYGKMQRWTGagtsgkagigaRRAVVLRFLascPTEEMAVFMDLILA 1044
gi 260788714   828 LFSIDqe-------sSvvqqehregLLPVLFRLLYGRMQQKTGegtqgrqgarvRTALVLRFLggcTPEELENFLDMILA 900
gi 1005965770  996 LFGSRgpn----pdeEhvkpehrsaVIPFVMRILYGKMLSKTGsrtagkanfdlRRSIVFRFLascSKDEIMSFLKLSFA 1071
gi 198420489   908 NFEIS----------Slled--rdvVAPILLRILFGRMRSKTGgssggkqnsstRRSIIIRFLagvSSSELEDFIYLIVE 975
gi 768944429   997 HFNISee------tgVvnas-hratLIPLLMRILFGRLRSKAGskfqgkasaasRSSIILRFLagcQTEELGIFIDLLLE 1069
gi 765159049   845 HFNISee------tgVveap-hrgkLIPVLMRILFGRLRSKAGsrfqgkssagvRSSIILRFLagcQAEELGMFVDLLLE 917
gi 542225145  1006 HFNISee------tgVvdas-hrgkLIPLLMRILFGRLRSKAGskfqgkasatyRSSIILRFLagcQAEELGMFIDLLFE 1078
gi 597778293   998 QFNISee------gsVvlel-hrpkLIPMLMRILYGRMRTKAGnkfqgkavaatRSAIVLRFLagcQPEELAMFMDLLLE 1070
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054   984 YFEKLlr---sNpletyrt-inesntrFEEDLPVYRIQVLMKMIDSIREQFGGLKdE-SFIQYLLHI---KF-CMDSI-- 1052
gi 972982186   951 PVRHYsqgpclAavqra-----leqtdLSRVLPLGQQHSILNSIELVIKRLGHLI-H-HYLPKILQI---LL-CVTAS-- 1017
gi 156361147  1045 PFKHFs-----Sevgvs-----pdsvdLSAVVPLKIQQGYLTMMGQILHQLGGAV-N-RFLPHLLHIclvLLyACAHA-- 1110
gi 260788714   901 PFAHLmn---tDvscvelvrqeatsldLSAVIPLSKQQGSLATVQVLLNKMGNLL-Q-GYIPRMFR----LLvVMVTS-- 969
gi 1005965770 1072 GFVHLfe---vKpmeilf---slkqidIHRCIPLKYVQGCLKTLELMFMHFGNVV-S-NLLPILNKI---LLiVTSYArv 1140
gi 198420489   976 PYKAVaq---sDknvmei---veedvgTRQVVPLARQLGVVNTLQMLLNKLNKQL-PlKSYSLILRI---LLyIVKLN-- 1043
gi 768944429  1070 PISHYsqgsclaav-----dkavaetdAGSILPLGRQHSLLNIINVVIHKLGHLI-H-NYLPKVLQI---LL-CVTAS-- 1136
gi 765159049   918 PVQHHsrgscleav-----qraasdadPAAVLPLGRQHSLLNVLDVVIHKLGHLI-H-AHLPKVLQV---LL-CVTAS-- 984
gi 542225145  1079 PVSHHcqgsclaav-----qraiadtdLGAVLPLGRLHSLLNTINVVIQKLGHLI-H-VYLPKVLQI---LV-CVTAS-- 1145
gi 597778293  1071 PVCHYsqgaclaav-----ekavaetdLSAVLPLGRQHGLLNVIDVVIKKLGHLI-R-FYLPKLLQM---VL-CVTAS-- 1137
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054  1053 ---LTRMD----Hsa----------------vKQLKSQALINLVEFFDHFDSYk--W-T-P-EeIETVFAIYVRPQLEKL 1104
gi 972982186  1018 ---ASAVL----Drreqvqa------gcrsplKNLRRLGILRIQDFFDGFESYs--FaA-E-E-VDAVFLAVVWPQVTRL 1079
gi 156361147  1111 ---LQHRD----Qvnpcy----------isllKSIRQLAITRIVDFFEMLPAFd--F-S-T-V-CEDVLKAAVWPQVESL 1167
gi 260788714   970 ---HTRIL----Dsrhlvrk------nllqlvKKVRTLAMRRLLELFQQHDQYs--F-S-RdE-IEALFTGVVWPQLDQQ 1031
gi 1005965770 1141 lldQRLLLntqaVsr----------------lKAIRTDCFKLTEKFFTLFETYh--F-TsE-E-LDALFEALLDPMIVNL 1199
gi 198420489  1044 ---TLHLT----QstndndenqlinpkfitplKSIKKQVQECLITLLTAWPDEapmL-G-S-Q-IDEIFDANIWCDLHKL 1112
gi 768944429  1137 ---VSTLL----Drrdqlrp------gcisplKNLRRLGILRIQDFFDNFDWYd--F-S-P-DeCDAIFQAVVWPQVCRL 1198
gi 765159049   985 ---VSAVL----Dnreqlrp------gcisplKNLRRLGVLKIQDFFDGFDSYd--F-S-S-VeIDAVFQAVVWPQVCRL 1046
gi 542225145  1146 ---VSTIL----Dqrdqlra------gcinplKNLRRLGILRILDFFDCFDTYs--F-R-P-DeIDAVFEAAIWPQVRRL 1207
gi 597778293  1138 ---VSCLL----Dhreqlka------gcinplKNLRRLGLLRIQEFFDSFDSYs--F-T-A-DeLDAVFHSVIWPQVCRL 1199
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054  1105 ETECIHSPTPLLKLFIAWSKNPRYYQFLArslseefaleSTPLASIVNLLNgDKTSDAVCQEILKMITSMLTLDTSESEI 1184
gi 972982186  1080 PSESPYAPTPLLKLLHVWSRNARYFPLLAkqkp--grpeCDVLHNVFALLSaKNVSQATVSVVMDVAESLVSAPDFEPGE 1157
gi 156361147  1168 AQETIQSPTPLLKLFHCWSKNPRYHPLLSrkpv--ncpdTSIMSNVYDCLKaVNVNQSVVTMVMEMTENLLSAEEYVTEG 1245
gi 260788714  1032 RSEVIYQPTPLLRLVHLWSKNLRYHPLLAksrp--dqpdRNLIDDIIATFFtPTSAPPVVAMVMEVVGHLLLESESEDAV 1109
gi 1005965770 1200 ANESLENPSPLLRLLHCWSCNPRYFILFVkkhs--leadVTPLSCLISLYSsNKAANSVIDYISNILANLLSYENHNPME 1277
gi 198420489  1113 NYESSGHPTVMLKLFKVFATNLRFLPWLArvgg--hdgnVTPISVVVETLNsDKTSANVSTFILDILNDVLFSDEEEMEK 1190
gi 768944429  1199 PTESTYSPTPLLKLIHLWCKNARYFPLLAkqrp--nqpeCDVLRNVFALLSaKNTSLGTITMVMDIADSLATTDYSVGTE 1276
gi 765159049  1047 PTESPYSPTPLLKLVHVWCKNARYFPLLAkqkl--dqpeCDVLLNVFALLSaKNASPATIAMVMDIAESLATTEDFVHSE 1124
gi 542225145  1208 QTESTYSPTPLLKLIHVWSKDARYFPLLAkqkp--dhpeCDILLNVFALLSaKKVSPATIAVVMDIAEYLATAADFVASD 1285
gi 597778293  1200 PTESPYAPTPLLRLVHVWSQNSRYFPLLAkqrp--dhpeCDVLLNVFALLSaKNVSPSTASMVMDICESLLNTPDFVPSE 1277
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054  1185 Itvpnsrp-------------vdntyneSEmn---------------------lgTSLLMPFVMDIISYIQKI------M 1224
gi 972982186  1158 Ga--------------------------GPltvgccvvpepaegtgaagehltlgCKLLLPCIPAVLQYLSGVvgnaerM 1211
gi 156361147  1246 Svteggvteggv-----teggiqvpscaPSps---------------------ysTKLVLPHLSSLLDHLRAT------V 1293
gi 260788714  1110 Dv--------------------------EPlevpgctilcge--tsgkdseapigTRLLLTHVAAILGHLRSA------V 1155
gi 1005965770 1278 DdeesviphlevnylidesynamyrttsDEmn---------------------lgTHIMIPYISPILSRIRVN------L 1330
gi 198420489  1191 DrdhisqqiqlglqsvggllfnakakieTRle---------------------lgILVLQPHMKPIVDFFIEK------M 1243
gi 768944429  1277 Iekeltvndcvfp----qpeegalisadTlg----------------------qgSRLLLPHISTLLGYLSGV------V 1324
gi 765159049  1125 Teralnvdgc---------vfpqpeegaALsads-----------------lsqgCRLLLPHISTLLHYFSTV------V 1172
gi 542225145  1286 Temelsvngcvf-----pqpaegaliaaDSlt---------------------qgSRLLLPHIPTLLRYFSGI------V 1333
gi 597778293  1278 Aetelsvnqc---------vipesdittDSlt---------------------vgSKLLLPHIPTLLRYLSGA------V 1321
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054  1225 --------Kr---------kRSISKD--HLLVLSRIAEYVKNEECCDAIADMLLPMLVRr--VTLPNvDmdtiQQMHVAL 1283
gi 972982186  1212 --------Kkkk------frAQV-SK--ELGILSKISKFVSDKEQSSVLIRLLLPYLHKpnnT--QEtE----IDILETT 1268
gi 156361147  1294 kslsksskKnsl------krSALPKL--ELSVLSKISPFVNTAEDSESLIRLLLPFLYMrq---rEEtE----NNTLRTI 1358
gi 260788714  1156 --------QsigaaggrqnrPKLPLS--ELNILSRISAYVKDPRQSAVLVGLLLPYLRRp-aITDHSaQ----VDILVTV 1220
gi 1005965770 1331 --------Snrla---kskrREVIIRdnETIILSHLSVLVEKEEDCIALVNLLIDSINYqhdKIEESa-----IKALESI 1394
gi 198420489  1244 --------Rksk------kgLLVTPK--QLKLLSLLSENIADKSLLSQLSEILLSHVSSvssKTTEKsV----IPALETL 1303
gi 768944429  1325 --------RntdrlkrkkfrVQVA-K--ELNILSKISRFVSEKEQSSVLIGLLLPYLQRa-nNPQET-E----IDILATV 1387
gi 765159049  1173 --------CnadrlrkkkfrAQVS-K--ELNILSKISRFVSDKEQSSLLVRLLLPFLLKg-hNAQET-E----IDILATI 1235
gi 542225145  1334 --------RntdrlkkkkfrVQVA-K--ELNILSKVSRFVSNKEQSSMLISLLLPYLQKg-nKSQET-E----IDLLATI 1396
gi 597778293  1322 --------QnsdrmkkknlrVQVS-K--ELNILSKISRFVSDKEQSSTLITLLLPYLYKq--IVEET-Q----IDILGTV 1383
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054  1284 YSLMKMV-PHPEKHLRKIGVLLERVLDLATRKVISQMIQLIAekSGsTehVRCASILEDMNAMDKRWLEQPDYERRLGAF 1362
gi 972982186  1269 QNLLKQS-ANPAAFLKPIARLFSIIQNKLSRQTLCRLFQTLAdlDSgL--KYITDITAKLNAFDRKHLDEVNFDLRLSAF 1345
gi 156361147  1359 QNLLRNV-ESPSSFSKTLGRLFSQLNARTSRRSLCEVFQEIAklEPhF--EVIASIVVDMNSWDPKRIEEPNFEARVGAF 1435
gi 260788714  1221 GNLVRQV-PDPKACWEQLATMLSSLEGREPRGELCKVFAAVAerDPsV--REISTIIHDLNTWDRKRVEEPDYDTRLSAF 1297
gi 1005965770 1395 NNLIGKIkNNARQFILKLCRLFELIHDRNARIKLCEILTTVSknLPkL--EALVEVIAMINTYNPRNPEEPDYSVREEGF 1472
gi 198420489  1304 SHVIQG-----TSLLPKLSKLFSKISDRETRIWLVTVLKAACksDSqF--QWTSDIVTRLNAWDKRFIEEMNFDARLTAF 1376
gi 768944429  1388 QNLLRQS-LKPSAFLQPLSKLFSIIQNKLPRQALTNVFQTLSdlDPsL--SYITDMASKLNAFDSRHLDEIYFDVRLTAF 1464
gi 765159049  1236 QNLLRRC-ERPSAFLRPLSRLFAVVHNKLPRKALTAVFQTLSdlDPsL--SYITDMTAKLNAFDSRHLDEIYFDVRLTAF 1312
gi 542225145  1397 QNLLRQC-DKPSVFLRPLSKLFSIIHNKLPRQALTNVFQTLSdlDPsL--TYITDLATKLNAFDSRHLDEIHFDVRLTAF 1473
gi 597778293  1384 HNLLKQC-SEPIVFLKPLSKLFSVIHSRLPRQALCDIFKTLAelHGeL--KYITDVVVELNSFDSRHLDEIHFDVRLLAF 1460
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122105054  1363 ---RTIDR---MmenG-ETLG------IDLTI-LFVHQCFY-YLKTDSDLAVRDNTNHFLRKVTIHS-IKMFgSEkEaET 1426
gi 972982186  1346 ---QSVTT---Hi-kEmTTLD------VSYLF-TVMQNCFH-SI-ELGDMSLGDSATLCLMAIIAQV-ATVDhT--AeEF 1406
gi 156361147  1436 ---SAASRlvlR---GtGVLP------VDKLL-PLLHNCLY-FIHRTDDLSIRDSAVSGLHAIIRRV-AAREt-----EF 1495
gi 260788714  1298 ---KSVDQ---Am-qDwVAID------TTFAL-PIIHNCFH-IVLRIEDFSLRSNASYCVTQVLQKM-EATSsTQe--EY 1359
gi 1005965770 1473 skaRKIIQ---G---ItESSV------PSDWIkILIHNCVF-FINTSEDIGLRESSSTCLSLIIKQL-Ss---FEnLkHF 1535
gi 198420489  1377 ---NDVCD---K---LnKDSDflfqdnCLKFI-PVLHCCLHtMLHLYSDISLRESVSRALTLVIHKVkAAKDrEDfKvIY 1446
gi 768944429  1465 ---QDATR---Rv-kEmSTLD------LNYIS-TLIHNCFH--TYEIGDMSLGDNATFCLSAVITQL-VAVEaGE-Q-IY 1525
gi 765159049  1313 ---QDATR---Rv-rDlQTLD------LDFIS-TVVYNCFH--TYEIGDMSLADNATLCLSTVIGRL-AAVGpGE-Q-IY 1373
gi 542225145  1474 ---QDATR---Rv-kGmQTLD------LDYIS-TVIHNCFH--TYEIGDMSLGDNATLCLSAVITQL-AAVGpGE-Q-IY 1534
gi 597778293  1461 ---QKAIK---Hi-gQmSVLD------MRYLT-AVMHNCFH--SFQIGDMSLADTSTLCLSAVIKQL-AAVGcPEq--EY 1521
                          730       740
                   ....*....|....*....|.
gi 122105054  1427 KYLIERVILT-ALMKGIKDKN 1446
gi 972982186  1407 REIIQRTMLE-AVKRGLRSKT 1426
gi 156361147  1496 EDVIVNCVLP-SVKLALRAKN 1515
gi 260788714  1360 KKVVQGTILP-LVRKGLWSRN 1379
gi 1005965770 1536 QSIVMSIIFQiHIKKGMKNLN 1556
gi 198420489  1447 KAVIKDFLLP-SVQSGLKSPD 1466
gi 768944429  1526 KDIVQHTILD-AVIKGLRSKT 1545
gi 765159049  1374 RDLIQHTILD-AVLKGLRSKT 1393
gi 542225145  1535 RDVVQHIILD-AVHKGLRSKT 1554
gi 597778293  1522 REIVHQTVLD-AVRRGLKSKT 1541
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap