Conserved Protein Domain Family
ATP12

?
pfam07542: ATP12 
Click on image for an interactive view with Cn3D
ATP12 chaperone protein
Mitochondrial F1-ATPase is an oligomeric enzyme composed of five distinct subunit polypeptides. The alpha and beta subunits make up the bulk of protein mass of F1. In Saccharomyces cerevisiae both subunits are synthesized as precursors with amino-terminal targeting signals that are removed upon translocation of the proteins to the matrix compartment. These proteins include examples from eukaryotes and bacteria and may have chaperone activity, being involved in F1 ATPase complex assembly.
Statistics
?
PSSM-Id: 311478
View PSSM: pfam07542
Aligned: 247 rows
Threshold Bit Score: 99.4882
Threshold Setting Gi: 290990213
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2R6I_B        53 RFYKDVTVadve-----eggFTILLDGKPLRTPAKKPLVAPSRALADLLRDEWDAQKEVvNPVVXPVSRHVNTAID-GI- 125
gi 121971863  23 KFYKKATVkklenpvhnkhlYGVFLDGKLIRTPLKNKLALPTYELAFAIAHEFNMQNEYlKPATMPITSISRTTVDmDIq 102
gi 124444092  24 RFYKEATIematnptnpyhqWLVKLDGKTVKTPSKNTLAVPSPQLASFIAHEFNMQTEYiRPTTMPLLTLARNAIDiEAd 103
gi 124466627  24 RFYKDVKIemafgeadpyrqWLVKLDGKTVKTPSKNELSIPTPQLAQRIADEFSAQAEFiNPATMPLMTLARNAVDiEAd 103
gi 124450372  24 RTYKEATVemainpinpyhqWFIKLDGKSIKTQQRNILAVPSPQLAACIAQEFNRQKEFlSFKQMPLMMLARNAIDlDYd 103
gi 124466986  16 RCYKEASIemasnpanpfhqWIIKLDGKSIKTQKRNILAVPSPQLASYIASEFNNQNKNmSLLSMQLFLLASHAVDlDFd 95
gi 74850933   91 RWYKTAGMcrtepe-npdqgYYPLIDERKIRTPSNHVIITPSKEIAYAVAAEWRAQEKYiKPSRLPITQTIISCLDvR-- 167
gi 281210418 102 RWYKHVGYtfda----enngYLPLLDNRPMKTVNRKLFIVPTKEIAMAIATEWMVQGKYiMPHRLPLTTVAATCIDm--- 174
gi 470242346 146 KWYKHVGYtydq----ekggYVPTLDNRAMKTPCGNHFVLPTKELAMAVAAEWHTQTTYiKPSRLPLSSALATCVDl--- 218
gi 330804137  81 RWYKTTGYtyde----elggYLPTIDDRRIKTPNDILVVVPSKEIALSIAAEWAAQEKYiRPARLPITQTIITCLEiR-- 154
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
2R6I_B       126 -ASDTQAVFEDILRFSSSDLLCYR-AGDPEALVARQTDYWDPVLDWAT 171
gi 121971863 103 eN-IRQHIEDSVNQFVRNDTILFR---EEGKLGVIQNEKLNPVIEYVN 146
gi 124444092 104 dR-IRQFMEQSIISYLERDTVLFR-ENPETKLYKIQKEKLDPQLKIFN 149
gi 124466627 104 eN-MREFMEHSIISYLERDTVLFR-EQSHSELYQIQMQKLDPQLKLFN 149
gi 124450372 104 aT-NREYTEKTIISHLENDIILHR-RNQNSQLLKIQQQQLDPQLRLFN 149
gi 124466986  96 aS-SRDIMEMSFIGNFENDVILKR-HQSQDKLLQKESQTFEPLIAQLN 141
gi 74850933  168 -PEGRFKIIGEFINHLATDPICNR-EKNDSKLKKLQSELYEPILQFAN 213
gi 281210418 175 nPESRQKCIDELIGHLATDQVCNR-DSDETQLKKLQNEAFDDLLHWss 221
gi 470242346 219 tPEQRLKSITEIVGHLKTDPVCNReADESSKMRKLQDEKLDPVFEFAN 266
gi 330804137 155 -PEGREKVIGEFLNHLATDPTCNR-EMYDSKLQKLQKEFFDPVVNFAS 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap