4EAZ


Conserved Protein Domain Family
Vg_Tdu

?
pfam07545: Vg_Tdu 
Click on image for an interactive view with Cn3D
Vestigial/Tondu family
The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. Transcriptional activation by these proteins likely requires interactions with specific coactivators. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed. This short conserved region is needed for interaction with Sd.
Statistics
?
PSSM-Id: 336735
View PSSM: pfam07545
Aligned: 18 rows
Threshold Bit Score: 53.4947
Threshold Setting Gi: 198414019
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|.
4EAZ_C        16 TEWNAGSVIFTYFEGDINSXVDEHFSRALRN 46
gi 50401659   21 TEWNAGSVIFTYFEGDINSMVDEHFSRALRN 51
gi 50401557   78 EYINSRCVLFTYFQGDISSVVDEHFSRALSH 108
gi 198414017 108 hHISSRCVMFNYFDGETSNEVDEHFTRALNH 138
gi 198414019  42 EYIRSRCYLVTYFKGHPRDKVDEHFNRSLRH 72
gi 565311073  20 TEWGAHYMVLTYFQGDTNSMVDEHFSRALSi 50
gi 959073965  20 TEWGSQSVVFTYFQGDINSMVDQHFSRALGN 50
gi 697411482  20 TEWGSQCVVFTYFQGDINSVVDEHFSRALSN 50
gi 821494133  25 tERSSRYVLFTYFQGDINSVVDEHFSRALSN 55
gi 301606047  20 TELGSRCVVFTYYQGDINSVVDEHFSRALRT 50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap