Conserved Protein Domain Family
Vg_Tdu

?
pfam07545: Vg_Tdu 
Click on image for an interactive view with Cn3D
Vestigial/Tondu family
The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. Transcriptional activation by these proteins likely requires interactions with specific coactivators. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed. This short conserved region is needed for interaction with Sd.
Statistics
?
PSSM-Id: 311481
View PSSM: pfam07545
Aligned: 18 rows
Threshold Bit Score: 53.1138
Threshold Setting Gi: 198414019
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|.
4EAZ_C         16 TEWNAGSVIFTYFEGDINSXVDEHFSRALRN 46
gi 50401557    78 EYINSRCVLFTYFQGDISSVVDEHFSRALSH 108
gi 198414017  108 hHISSRCVMFNYFDGETSNEVDEHFTRALNH 138
gi 565311073   20 TEWGAHYMVLTYFQGDTNSMVDEHFSRALSi 50
gi 959073965   20 TEWGSQSVVFTYFQGDINSMVDQHFSRALGN 50
gi 697411482   20 TEWGSQCVVFTYFQGDINSVVDEHFSRALSN 50
gi 821494133   25 tERSSRYVLFTYFQGDINSVVDEHFSRALSN 55
gi 301606047   20 TELGSRCVVFTYYQGDINSVVDEHFSRALRT 50
gi 1040698911  52 EYLSARCVVFTYFRGDIGDVVDEHFSRALSQ 82
gi 357612029  210 QYVSANCVVFTHYSGDVAAVVDDHFTRALSl 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap