Conserved Protein Domain Family
Shugoshin_N

?
pfam07558: Shugoshin_N 
Shugoshin N-terminal coiled-coil region
The Shugoshin protein is found to have this conserved N-terminal coiled-coil region and a highly conserved C-terminal basic region, family Shugoshin_C pfam07557. Shugoshin is a crucial target of Bub1 kinase function at kinetochores, necessary for both meiotic and mitotic localization of shugoshin to the kinetochore. Human shugoshin is diffusible and mediates kinetochore-driven formation of kinetochore-microtubules during bipolar spindle assembly. Further, the primary role of shugoshin is to ensure bipolar attachment of kinetochores, and its role in protecting cohesion has co-developed to facilitate this process.
Statistics
?
PSSM-Id: 311492
View PSSM: pfam07558
Aligned: 52 rows
Threshold Bit Score: 34.8971
Threshold Setting Gi: 75339606
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 62287481    21 LKKKFLKQNREIIKINTQLSIKIRESENEIQDLIQENFTLKSYLV 65
gi 75339606    37 NKPVALADITNTGKPNAARSITVPDLVKENTKLLTL-LNEKTKII 80
gi 81904326    22 MKEKRNKNLAGIGKRKSFIVAPGQVPTNTATLLRYYQDNNRLLVL 66
gi 1018974570  22 MKEKRNKKLAKLGKTNSILSAKCKIITNNSTQLKSFQENNRALAL 66
gi 444320021   62 yKDEYSQQNNELAKSNSALKLKINSMEKTINELIQENVLLRSNTS 106
gi 965909390   77 IKEKRSKNLTEI-KRKSLIIAPCQTITNTSKVL-SYEDNNRMLAL 119
gi 755765914   22 MKEKRSKNLAEIGKRKSFIAAPCQIITNTSTLLKNYQDNNRMLAL 66
gi 821488824   22 MKEKRNKRLAQIGKPKPILTAKCKILTNPSTQLKSYQENNRALAL 66
gi 366995035   41 LKIAYSQQNVQLAKDNSSLRLKINEMDKKLSQLIQENVILRSKLS 85
gi 255717358   45 irsGYTQQNAQLAKSNSSLMIKVREMDKSVSELIQENVLLRSKLS 89
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap